DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or85a

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:261 Identity:57/261 - (21%)
Similarity:104/261 - (39%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 ILVHWH----GYITVVCFVGADGFFLG---FCLY------------------FTVLLLCLQDDVC 229
            ::|.:|    ||:: :...||  ..:|   ||||                  .|:..:.|.:.:.
  Fly   141 VVVIYHCIYFGYLS-MALTGA--LVIGKTPFCLYNPLVNPDDHFYLATAIESVTMAGIILANLIL 202

  Fly   230 DL----------LEVENIEKSPSEAEEARIVR-EMEKLVDRHNEVAELTERLSG--VMVEI--TL 279
            |:          :.:|.:      :|..:.:| ::||..|:|  .|||.|.:..  ::||.  ||
  Fly   203 DVYPIIYVVVLRIHMELL------SERIKTLRTDVEKGDDQH--YAELVECVKDHKLIVEYGNTL 259

  Fly   280 AHFVTSSLIIGTSVVDILLFSGLGI------------IVYVVYTCAVGVEIFLYCLGGSHIMEAC 332
            ...:::::.|....|.:||  ||..            :|..|||.|:..:.|.:|.....:...|
  Fly   260 RPMISATMFIQLLSVGLLL--GLAAVSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLSSDC 322

  Fly   333 SNLARSTFSSHWYGHSVRVQKMTLLMVARAQR-VLTIKIPFFSPSLETLTSILRFTGSLIALAKS 396
            .:|..:.|.|.|.|...|.:...|..:...|: :|......|...|.|...:.:|..|::.:...
  Fly   323 ESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTIVNE 387

  Fly   397 V 397
            :
  Fly   388 M 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 56/250 (22%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 56/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.