DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or83c

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:257 Identity:55/257 - (21%)
Similarity:100/257 - (38%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 PFKMMFPD---------LLLRLPL-----YPITYILVHWHGYITVVCFVGADGFFLGFCLYFTVL 220
            |..|:..|         |:..|||     |.:||::.      ||...|...||:.|....|..|
  Fly   149 PLAMLMYDGTRVTAMQYLIPGLPLENNYCYVVTYMIQ------TVTMLVQGVGFYSGDLFVFLGL 207

  Fly   221 LLCLQDDVCDLLEVENIEKSPS---EAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHF 282
            ...|  ...|:|:|:..|.:.:   :||...:||     |....:.||..:||   ::::...|.
  Fly   208 TQIL--TFADMLQVKVKELNDALEQKAEYRALVR-----VGASIDGAENRQRL---LLDVIRWHQ 262

  Fly   283 VTSSL----------IIGTSVVDILLFSGLGIIVYV--------VYTCAVGVEIFLYCLGGSHIM 329
            :.:..          :|.|.|:.:.|...|...:.:        ::.......:.:||:.|:.:.
  Fly   263 LFTDYCRAINALYYELIATQVLSMALAMMLSFCINLSSFHMPSAIFFVVSAYSMSIYCILGTILE 327

  Fly   330 EACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKI-PFFSPSLETLTSILRFTGSL 390
            .|...:..|..:..||..|...:|:...::..:|....|:| ...|.|:.|...|::...|:
  Fly   328 FAYDQVYESICNVTWYELSGEQRKLFGFLLRESQYPHNIQILGVMSLSVRTALQIVKLIYSV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 54/253 (21%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 54/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.