DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or67d

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:438 Identity:80/438 - (18%)
Similarity:152/438 - (34%) Gaps:132/438 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PMERHYFMVPKFALSLIGFYPEQKRTVLVKLWSFFNFFILTYGCYA-----------EAYYGIHY 64
            |:|| |..|.:.....:||..........::|      .|||...|           ..|.|: .
  Fly     9 PVER-YCKVIRMIRFCVGFCGNDVADPNFRMW------WLTYAVMAAIAFFFACTGYTIYVGV-V 65

  Fly    65 IPINIATALDALCPVASSILSLVKMVAI---WWYQDELRSLIERVRFLTEQQKSKRKLGYKKRFY 126
            |..::...|.||..|.|::..|.|::..   ..:..|:::..|.:         .|:.|.|...|
  Fly    66 INGDLTIILQALAMVGSAVQGLTKLLVTANNASHMREVQNTYEDI---------YREYGSKGDEY 121

  Fly   127 TLATQLTFLLLCCGFCTSTSYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPITYIL 191
            .                       ..::..:|.|    |.....|.:::..||..:..:||.|:|
  Fly   122 A-----------------------KCLEKRIRIT----WTLLIGFMLVYIILLGLVITFPIFYLL 159

  Fly   192 VHWHGYITVVCFV------GADG-------------FFLGFCLY--------FTVLLLCLQDDVC 229
            : .|..:.|:.|:      ..||             .|.||..|        |...:..::|..|
  Fly   160 I-LHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGGDMYLFLFVTHVPLIKDIFC 223

  Fly   230 DLLEVENIEKSPSEAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVV 294
            ..|                  .|..:||.:.|:..::...|..::|...|   .|..|.....:.
  Fly   224 VKL------------------TEFNELVMKRNDFPKVRAMLCDLLVWHQL---YTRMLQTTKKIY 267

  Fly   295 DILLFSGL-----GII---------------VYVVYTCAVGVEIFLYCLGGSHIMEACSNLARST 339
            .|:||..|     |::               :|::|   ..:.::.:|..|:.:..:..:.....
  Fly   268 SIVLFVQLSTTCVGLLCTISCIFMKAWPAAPLYLLY---AAITLYTFCGLGTLVENSNEDFLSVI 329

  Fly   340 FSS-HWYGHSVRVQKMTLLMVARAQRVLTIKIPFFSP-SLETLTSILR 385
            ::: .||...|:.:|:.::|:|:||..:.:.....:| |:.|...:.:
  Fly   330 YTNCLWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 65/370 (18%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 65/370 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.