DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or67c

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:402 Identity:90/402 - (22%)
Similarity:172/402 - (42%) Gaps:82/402 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RTVLVKLW---SFFNFFILTYGCYAEAYYGIH-YIPINIATALDALCPVASSILSLVKMVAIWWY 95
            :::|.|::   .|.||.:|..|.....|..|. :..|.:|.|: |.| :..|:::..|..|:...
  Fly    40 KSLLFKIYLYAGFINFNLLVIGELVFFYNSIQDFETIRLAIAV-APC-IGFSLVADFKQAAMIRG 102

  Fly    96 QDELRSLIERVRFLTEQQKSKRKLGYK--------KRFYTLATQLTFLLLCCGFCTSTSY----- 147
            :..|..|::.:..:..:..:| ::.||        ||...:     |..||..:.|:.|:     
  Fly   103 KKTLIMLLDDLENMHPKTLAK-QMEYKLPDFEKTMKRVINI-----FTFLCLAYTTTFSFYPAIK 161

  Fly   148 -SVRHLIDNILRRTHGKDWIYET-----PFKMMFPDLLLRLPLYPITYILVHW---HG-YITVVC 202
             ||:.   |.|.        |:|     .|.:.||....|..|   .|.:::|   || |:..:.
  Fly   162 ASVKF---NFLG--------YDTFDRNFGFLIWFPFDATRNNL---IYWIMYWDIAHGAYLAGIA 212

  Fly   203 FVGADGFFL----GFCLYFTVLLLCLQDDVCDLLE-VENIEKSPSEAEEARIVREMEKLVDRHNE 262
            |:.||...:    ..|::|..:.:.|:|..|:..| .||||             .:..::..|::
  Fly   213 FLCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKENIE-------------FLIGIIRYHDK 264

  Fly   263 VAELTERLSGVMVEITLAHFVTSSLII-------GTSVVDILLFSGLGIIVYVVYTCAVGVEIFL 320
            ..:|.|.::.:.....|.:|:.:|:.|       ..|.|::       ||:|.::.....|::|:
  Fly   265 CLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEV-------IIIYCIFLMTSMVQVFM 322

  Fly   321 YCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKIPFFSP-SLETLTSIL 384
            .|..|..::.|...:..:.::..|:..|.....|..|::.|:|:..:|:.|.|.| ||.|...::
  Fly   323 VCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVI 387

  Fly   385 RFTGSLIALAKS 396
            ..:....||.::
  Fly   388 SMSYQFFALLRT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 78/355 (22%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 74/344 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.