DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or67b

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:371 Identity:73/371 - (19%)
Similarity:147/371 - (39%) Gaps:64/371 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 INIATALDALCPVASSILSLVKMVAIWWYQDELRSLIERVRFLTEQQKSKRKLGY-------KKR 124
            |:..|.::|:.......:.:|||   :.:|:::.|..:.| |.||..:..:.||.       ||.
  Fly    72 ISFETYVEAVLLTFQLSVGVVKM---FHFQNKVESCSQLV-FSTETGEVLKSLGLFQLDLPRKKE 132

  Fly   125 FYTLATQLT--------------FLLLCCG---FCTSTSYSVRHLIDNILRRTHGKDWIYET-PF 171
            ..:..:.:.              |.::|..   :|....:  :::.|..::   .||....| .:
  Fly   133 LLSSVSLILLNNWMIIDRQVMFFFKIVCMPVLYYCVRPYF--QYIFDCYIK---DKDTCEMTLTY 192

  Fly   172 KMMFPDLLL---RLPLYPITYILVH----WHGYITVVCFVGADGF---FLGFCLY----FTVLLL 222
            ..:.|.|.|   ..|.|.|.:.|:.    |       ||....||   |:....|    ..||..
  Fly   193 PAIVPYLQLGNYEFPSYVIRFFLLQSGPLW-------CFFAVFGFNSLFVVLTRYESGLIKVLRF 250

  Fly   223 CLQDDVCDLLEVENIEKSPSEAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSL 287
            .:|:...|:|    :.|..........||...::...||::..|.:.:  ::|:.:::..:...|
  Fly   251 LVQNSTSDIL----VPKDQRVKYLQCCVRLFARISSHHNQIENLFKYI--ILVQCSVSSILICML 309

  Fly   288 IIGTSVVDILLFSGLGIIVYVVYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQ 352
            :...|.|..:.:..:|:|  :||...:.:||.||.:....:......|....::..||..|...:
  Fly   310 LYKISTVLEVGWVWMGMI--MVYFVTIALEITLYNVSAQKVESQSELLFHDWYNCSWYNESREFK 372

  Fly   353 KMTLLMVARAQRVLTIKI-PFFSPSLETLTSILRFTGSLIALAKSV 397
            .|..:|:..::|...:.: .|.|.|.:.|..:.|.:.:...|.:::
  Fly   373 FMIKMMLLFSRRTFVLSVGGFTSLSHKFLVQVFRLSANFFLLLRNM 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 71/359 (20%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 49/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.