DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or56a

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:406 Identity:87/406 - (21%)
Similarity:138/406 - (33%) Gaps:121/406 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 WY-----QDELRSLIERVR--------------FLTEQQKSKRKLGYKKRFYTLATQLTFLLLCC 139
            ||     :|:.|.|:..:|              .|....:....|......|..|.|.       
  Fly    28 WYGYVASKDQNRPLLSLIRCTILTASIWLSCALMLARVFRGYENLNDGATSYATAVQY------- 85

  Fly   140 GFCTS----TSYSVRHLIDNILRRTHG--KDWIYETPFKMMFPDLLLRLPLYPITYILVHW---- 194
             |..|    .:|..|..:.::||..|.  ::.::|...:.|  :||:....|..|..|:.|    
  Fly    86 -FAVSIAMFNAYVQRDKVISLLRVAHSDIQNLMHEADNREM--ELLVATQAYTRTITLLIWIPSV 147

  Fly   195 --------------------------------HGYITVVCF-VG--ADGFFLGFC---------- 214
                                            |..:....| .|  .|.|.:|:.          
  Fly   148 IAGLMAYSDCIYRSLFLPKSVFNVPAVRRGEEHPILLFQLFPFGELCDNFVVGYLGPWYALGLGI 212

  Fly   215 ----LYFTVLLLCLQDDVCDLLEVENIEKSPSEAEEARIVREMEKLVDRHNEVAELT---ERL-- 270
                |:.| .:.||...|...|::.|     ...||..|.|...|||......:|||   .:|  
  Fly   213 TAIPLWHT-FITCLMKYVNLKLQILN-----KRVEEMDITRLNSKLVIGRLTASELTFWQMQLFK 271

  Fly   271 SGVMVEITLAHFV--TSSLIIGTSVVDILLFSGLGIIVYVVYTCAVGVE---------IFLYCLG 324
            ..|..::.:..||  ...||....:.|.::||.|  |.::.:...|||.         |:|:.:.
  Fly   272 EFVKEQLRIRKFVQELQYLICVPVMADFIIFSVL--ICFLFFALTVGVPSKMDYFFMFIYLFVMA 334

  Fly   325 G---------SHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKIPFFSPSLETL 380
            |         :.|:|....|:.:.||..||...:.:|||.:.|:..|||.:.::......:|.|.
  Fly   335 GILWIYHWHATLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRALLVDLNLRTF 399

  Fly   381 TSILRFTGSLIALAKS 396
            ..|.|...|...|.:|
  Fly   400 IDIGRGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 84/396 (21%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 64/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.