DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or45a

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster


Alignment Length:420 Identity:79/420 - (18%)
Similarity:151/420 - (35%) Gaps:80/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MERHYFMVPKFALSLIGFYPEQKRTVLV-KLWSFFNFFILTYGCYAEAYYGIHYIPINIATALDA 75
            |:..||.|.:.||.::||.|...:..|. .:|:......|....:....|.:..:. ::....|.
  Fly     1 MDASYFAVQRRALEIVGFDPSTPQLSLKHPIWAGILILSLISHNWPMVVYALQDLS-DLTRLTDN 64

  Fly    76 LCPVASSILSLVKMVAIWWYQDELRSLIERVRFLTEQQKSKRKLGYKKRFYTLATQLTFLLLCCG 140
            .........|..|.:.:...:..:.|||.|:..|.:                             
  Fly    65 FAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLNQ----------------------------- 100

  Fly   141 FCTSTSYSVRHL--------IDNILRRTHGKDWIYETPFKMMFPDLLLRL----------PLYPI 187
               :.|.:..||        :|..:.|:. ::..|..........:||.|          |..|:
  Fly   101 ---AASATPNHLEKIERENQLDRYVARSF-RNAAYGVICASAIAPMLLGLWGYVETGVFTPTTPM 161

  Fly   188 TYIL--------VHWHGYITVVCFVGADGFFLGFCLYFTVLLLCLQDDVC---DLLEVENIEKSP 241
            .:..        .:|..|:..|..|.|..:   ..:....|...|..:|.   .|||:. :|:..
  Fly   162 EFNFWLDERKPHFYWPIYVWGVLGVAAAAW---LAIATDTLFSWLTHNVVIQFQLLELV-LEEKD 222

  Fly   242 SEAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSGLGIIV 306
            ....::|:.    ..|.||....:|.:.||.:..||....::.|.|.:   .:....||..|...
  Fly   223 LNGGDSRLT----GFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQL---CMLAFRFSRSGWSA 280

  Fly   307 YV----VYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSS-HWYGHSVRVQKMTLLMVARAQRVL 366
            .|    .:..|:.:::..||.||.:|.:....:|::.:.. :|...:.:.:::..:::.||||..
  Fly   281 QVPFRATFLVAIIIQLSSYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPA 345

  Fly   367 TIKIPFFSPSLETLTSILRFTGSLIALAKS 396
            .|....|...|..|..::|..||.:|:.::
  Fly   346 KIFGFMFVVDLPLLLWVIRTAGSFLAMLRT 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 63/353 (18%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 62/346 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.