DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or42b

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:408 Identity:79/408 - (19%)
Similarity:159/408 - (38%) Gaps:77/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ALSLIGFYPEQKRTV--LVKLWSFFNF-FILTY------GCYAEAYYGIHYIPINIATALDALCP 78
            |:..||:.|.::..:  :...|:...| :..||      |.|......  :.|....|:|.....
  Fly    27 AMKFIGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKS--FSPGEFLTSLQVCIN 89

  Fly    79 VASSILSLVKMVAIWWYQDELRSLIER--VRFLTEQQKSKRKLGYKKRFYTLATQLTFLLLCCGF 141
            ...|.:.:....::.|...:.::::::  :|....:::.|..|...:..:..   |.|..:.||:
  Fly    90 AYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAF---LIFTFVYCGY 151

  Fly   142 CTSTSYSVRHLIDNILRRTHGK-DWIYETPFKMMFPDLLLRLPLYPITYILVHWHG--------- 196
            ..||      .:.::|   .|: .|....||                    :.||.         
  Fly   152 AGST------YLSSVL---SGRPPWQLYNPF--------------------IDWHDGTLKLWVAS 187

  Fly   197 ---YITVVCFVGADGFFLGFCLYFTVLLLC----LQDDVCDLLEVENIEKSPSEAEEARIVREME 254
               |:.:...|..|.....:.|.:|::|..    |::.:..|...||:    ||||.   ..|:.
  Fly   188 TLEYMVMSGAVLQDQLSDSYPLIYTLILRAHLDMLRERIRRLRSDENL----SEAES---YEELV 245

  Fly   255 KLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFS----GLGIIVYVVYTCAVG 315
            |.|..|..:......:..|:.......|:...|::|.:::::..||    |:...::|:   .:.
  Fly   246 KCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMFVI---TIL 307

  Fly   316 VEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQR-VLTIKIPFFSPSLET 379
            ::.|.:|...:.|||.|.:|..:.|.|:|...|.|.:...|..:...|: ::.|....|..|:.:
  Fly   308 LQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSS 372

  Fly   380 LTSILRFTGSLIALAKSV 397
            ..|:.:|..|:|.:.|.:
  Fly   373 NISVAKFAFSVITITKQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 65/343 (19%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 66/346 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.