DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or22b

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:411 Identity:86/411 - (20%)
Similarity:155/411 - (37%) Gaps:107/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PEQKRTVL-VKLWSFF---NFFILTYGCYAEAYYGIHYIPINIATALDALCPV--ASSILSLVKM 89
            ||.||..| .||||.|   ..|||              :||:::.........  |...||.:: 
  Fly    39 PENKRWDLHYKLWSTFVTLLIFIL--------------LPISVSVEYIQRFKTFSAGEFLSSIQ- 88

  Fly    90 VAIWWYQDELRSLIERVRFLTEQQKSKRKLGYKKRFYTLAT--QLTFLLLC-------------C 139
            :.:..|....:|      :||       .:|||||.....:  :|....:|             .
  Fly    89 IGVNMYGSSFKS------YLT-------MMGYKKRQEAKMSLDELDKRCVCDEERTIVHRHVALG 140

  Fly   140 GFC------TSTSYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPITYILVHWHGYI 198
            .||      ..||:.:.:.:..|::|.|.  |      :|.||            |:......||
  Fly   141 NFCYIFYHIAYTSFLISNFLSFIMKRIHA--W------RMYFP------------YVDPEKQFYI 185

  Fly   199 TVVCFVGADGF--FLGFCLYFTVLLLCLQDDVCDLL--------------EVENIEKSPSEAEEA 247
            :.:..|...|:  |:..|           .|||.|:              .:.|:...|...|: 
  Fly   186 SSIAEVILRGWAVFMDLC-----------TDVCPLISMVIARCHITLLKQRLRNLRSEPGRTED- 238

  Fly   248 RIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSGL--GIIVYVVY 310
            ..::|:...|..|..:.:..:.|..|........|:...:::|.|:::|:.||.|  |:.|.:..
  Fly   239 EYLKELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVLFM 303

  Fly   311 TCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKI-PFFS 374
            :| |.::.|.:|...:.||:.|..:|.|.|.|.|.....|.:...:..:...|:.:.:.. ..|.
  Fly   304 SC-VSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFP 367

  Fly   375 PSLETLTSILRFTGSLIALAK 395
            .|::|..::::...:::.:.|
  Fly   368 ISMQTNLNMVKLAFTVVTIVK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 70/361 (19%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 69/346 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.