DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or65c

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:366 Identity:77/366 - (21%)
Similarity:138/366 - (37%) Gaps:117/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 KMVAIWWYQDELRSLIERVR-FLTEQQKSKRKLGYK--KRFY-TLATQL--TFLLLCCGFCTSTS 146
            |:....||.|||..::|.:. |....||....:.|:  ||:| |||..|  ::|:..|.|     
  Fly   105 KIYYFQWYGDELDEVVEALETFHPWAQKGPGAVDYRTAKRWYFTLAFFLASSWLVFLCIF----- 164

  Fly   147 YSVRHLIDNILRRTHGKDWIYE--TPFKMMFPDLLLRLPLYPITYILVH----WH--GYIT-VVC 202
              :..||.:.|       |:::  .|....||.......::||::..::    |:  .::| :||
  Fly   165 --ILLLITSPL-------WVHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFLTWLVC 220

  Fly   203 FVGADGFFLGFCLY----FTVLLLCLQDDVCDLLEVENIEKSPSEAEEARIVREMEKLVDRHNEV 263
            ..|     |...:|    |.:.:||        ||:.::.:.....|:.|:  |..:||..|.::
  Fly   221 IEG-----LSVSIYVEITFAIEVLC--------LELRHLHQRCHGYEQLRL--ETNRLVQFHQKI 270

  Fly   264 AELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSGLGIIVYVVYTCAVGVEIFLYCLGGSHI 328
            ..:.:.              |:.:..||.::.                  :||..||..|.....
  Fly   271 VHILDH--------------TNKVFHGTLIMQ------------------MGVNFFLVSLSVLEA 303

  Fly   329 MEACSN------------LARSTFSS-HWYGHSVRVQKMTL----------------------LM 358
            |||..:            ||....|. .::|..:..:.:|:                      |:
  Fly   304 MEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLCLI 368

  Fly   359 VARAQRVLTIKI-PFFSPSLETLTSIL-RFTGSLIALAKSV 397
            :.|.|..|.::. ||.|.:....::|| :..|.|..|.|::
  Fly   369 IRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFLLKTL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 73/355 (21%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 73/354 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.