DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or2a

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:357 Identity:75/357 - (21%)
Similarity:143/357 - (40%) Gaps:61/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NIATALDALCPVASSILSLVKMVAIWWYQ---DELRSLIE----RVRFLTEQQKSKRKLGYKKRF 125
            |:|...:.|....:.|::.:|...::..:   .|:|||:.    |.|.:.:.:    ::...::.
  Fly    66 NMAGLCENLTITITDIVANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPE----EISALRKE 126

  Fly   126 YTLATQLTFLLLCCGFCTSTSYS-VRHLI----DNILRRTHGKDWIYETPFKMMFPDLLLRLPLY 185
            ..:| |.||......|...|:.| ||.::    :.:.....|.||::.|.               
  Fly   127 VNIA-QGTFRTFASIFVFGTTLSCVRVVVRPDRELLYPAWFGVDWMHSTR--------------- 175

  Fly   186 PITYILVHWHGYITVV------CFVGADGFFLGFCLYFTVLLLCLQDDVCDLLEVENI----EKS 240
              .|:|::.:....::      |  .:|.:...|....|..:..|:      |.|..|    |||
  Fly   176 --NYVLINIYQLFGLIVQAIQNC--ASDSYPPAFLCLLTGHMRALE------LRVRRIGCRTEKS 230

  Fly   241 PS----EAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSG 301
            ..    ||....:.:|:.:.:.....|..|.|.:..|:....:|.||.|:.:..|..:..|..:.
  Fly   231 NKGQTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVAD 295

  Fly   302 ----LGIIVYVVYTCAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARA 362
                ..:|:.:|:..||.:|:|:.|..|..:......|..:.:..:|.....:.::..|..:||.
  Fly   296 DHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLART 360

  Fly   363 QRVLTIKI-PFFSPSLETLTSILRFTGSLIAL 393
            ||...|.. .:.:.||||...::|||.|:..|
  Fly   361 QRPSLIYAGNYIALSLETFEQVMRFTYSVFTL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 72/350 (21%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 72/350 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.