DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and Or69a

DIOPT Version :9

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:412 Identity:81/412 - (19%)
Similarity:157/412 - (38%) Gaps:96/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EQKRTVLVKLWSFFNFFILTY---GCYAEAYYG-------IHYIPINIATALDALCPVASSI--- 83
            |.||.:..::..:.....|.|   ||....|:|       |.|        |..|..|||.:   
  Fly    31 EVKRNLAKRIIFWLGAVNLVYHNIGCVMYGYFGDGRTKDPIAY--------LAELASVASMLGFT 87

  Fly    84 ----LSLVKMVAIWWYQDELRSLIERVRFLTEQQKSKRKLGYKKRFYTLATQLTFLLLCCGFCTS 144
                |:|.||:::..:.:.|.:..|.: |...:.::.|...|::: ||...:.||:     |.||
  Fly    88 IVGTLNLWKMLSLKTHFENLLNEFEEL-FQLIKHRAYRIHHYQEK-YTRHIRNTFI-----FHTS 145

  Fly   145 TSYSVRHLIDNILRRTH---GKDWIYETPFKMMFPDLLLRLPLYPITYILVHWH------GYI-T 199
            .......|...::.|.|   .:...|.......:|                 |.      |:. .
  Fly   146 AVVYYNSLPILLMIREHFSNSQQLGYRIQSNTWYP-----------------WQVQGSIPGFFAA 193

  Fly   200 VVCFVGA------DGFFLGFCLYFTVLLLCLQDDVCDLLEVENIEKSPSEAEEARIVREMEKLVD 258
            |.|.:.:      ...|:.|.:.|..:.|.:..|.. ..::|.|:.....|::     :::.|:.
  Fly   194 VACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGL-ARQLETIDARNPHAKD-----QLKYLIV 252

  Fly   259 RHNEVAELTER------------LSGVMVEITLAHFVTSSLIIGTSVVDILLFSGLGIIVYVVYT 311
            .|.::..|.:|            ||..|:......|..:....|||:..:     ||:::::.|.
  Fly   253 YHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHL-----LGLLLFITYN 312

  Fly   312 CAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKIPFFSP- 375
                   |..|..|:|::.....:..:.|.::||...:..::|.|:::.||.:....|....:| 
  Fly   313 -------FSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPV 370

  Fly   376 SLETLTSILRFTGSLIALAKSV 397
            |:.|..:.|:|:..:....:|:
  Fly   371 SITTYMATLKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 69/355 (19%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 69/350 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.