DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2955 and ebp-3

DIOPT Version :10

Sequence 1:NP_608817.1 Gene:CG2955 / 33622 FlyBaseID:FBgn0031585 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_507528.1 Gene:ebp-3 / 180181 WormBaseID:WBGene00007062 Length:187 Species:Caenorhabditis elegans


Alignment Length:70 Identity:16/70 - (22%)
Similarity:30/70 - (42%) Gaps:17/70 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 LDLGELSTLTHDIHRTETDLKKSDEERVSLIAELDSSPDEWSSTWQSTYENALPIDVIDFKEQHL 406
            :|:...:.|..::......|.:||    ::||.|:...|.:.|..::       |:||      .
 Worm    99 VDMATFNKLKEELEEVTRQLTESD----NVIASLEKERDFYFSKLRT-------IEVI------C 146

  Fly   407 QQNQS 411
            |.|:|
 Worm   147 QDNES 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2955NP_608817.1 BIM1 10..>116 CDD:227542
ebp-3NP_507528.1 EB1 128..166 CDD:460870 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.