DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2955 and Mapre1

DIOPT Version :10

Sequence 1:NP_608817.1 Gene:CG2955 / 33622 FlyBaseID:FBgn0031585 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_031922.1 Gene:Mapre1 / 13589 MGIID:891995 Length:268 Species:Mus musculus


Alignment Length:107 Identity:42/107 - (39%)
Similarity:66/107 - (61%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NSASRRRILGWINNNLGTTYVRLEELRTGAEYCRMLHKLQPSAIRLKRVFKEPKSHYECVQNMKL 75
            ::.||..:|.|||.:|.....::|:|.:||.||:.:..|.|.:|.||:|..:.|..:|.:||.|:
Mouse    13 DNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKI 77

  Fly    76 LQKSLLKQGVEKQIPIQRLVSRGNSESLEFAQWFKAFYDHNH 117
            ||....:.||:|.||:.:||.....::.||.||||.|:|.|:
Mouse    78 LQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANY 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2955NP_608817.1 BIM1 10..>116 CDD:227542 41/104 (39%)
Mapre1NP_031922.1 BIM1 16..257 CDD:227542 42/104 (40%)
Interaction with MTUS2/TIP150. /evidence=ECO:0000250|UniProtKB:Q15691 124..268
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..180
Interaction with APC. /evidence=ECO:0000269|PubMed:15311282 206..211
DCTN1-binding. /evidence=ECO:0000250|UniProtKB:Q15691 208..268
APC-binding. /evidence=ECO:0000250|UniProtKB:Q15691 220..242
Interaction with SKA1. /evidence=ECO:0000250|UniProtKB:Q15691 232..255
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.