DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CI and mamdc2b

DIOPT Version :9

Sequence 1:NP_001285599.1 Gene:Sr-CI / 33621 FlyBaseID:FBgn0014033 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_017213507.1 Gene:mamdc2b / 798369 ZFINID:ZDB-GENE-091117-16 Length:698 Species:Danio rerio


Alignment Length:187 Identity:53/187 - (28%)
Similarity:78/187 - (41%) Gaps:57/187 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 CDFESEDQCGWEAETTFRRPWKRVSTVSDIHSLR-------TGPRHDHTFKNESG-GHYMRMETQ 192
            ||||| ..||:..:        :|....|.:..|       |||..|||    :| ||||.:|..
Zfish   516 CDFES-GLCGFSQD--------KVGDSGDWYLARGPTPTSYTGPGGDHT----TGLGHYMHIEAS 567

  Fly   193 MGAYG-SYHLLSPIYPRSLTL---KTACCFRFHYFMFGAGVDNLVVSVKPVSMPMAT-------- 245
            :...| ...|||.      ||   :...|.:|:|.|:|:|:..|       |:.:.|        
Zfish   568 VMLAGHKARLLSS------TLRGTRETQCLQFYYHMYGSGIGQL-------SVYLQTGQENDDRL 619

  Fly   246 MWNRFRANCSKFEISGQQGTQWLEHTISIDEMQEDFQVIFTATDARSQFGDIAIDDV 302
            :|..          .|:||..||..:::. ...:..|::|.||...|...|||:||:
Zfish   620 LWTS----------HGEQGISWLRASLNY-HYDQQHQIVFEATRGASVRSDIAVDDI 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CINP_001285599.1 CCP 22..72 CDD:214478
CCP 77..125 CDD:214478
MAM 131..308 CDD:214533 53/187 (28%)
MAM 136..308 CDD:99706 53/187 (28%)
Somatomedin_B 335..385 CDD:295334
mamdc2bXP_017213507.1 MAM 41..175 CDD:279023
MAM 41..175 CDD:99706
MAM 178..334 CDD:279023
MAM 178..334 CDD:99706
MAM 349..502 CDD:279023
MAM 349..502 CDD:99706
MAM 516..674 CDD:279023 53/187 (28%)
MAM 516..672 CDD:99706 53/187 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9895
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7243
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.