DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CI and Mdga1

DIOPT Version :10

Sequence 1:NP_477102.1 Gene:Sr-CI / 33621 FlyBaseID:FBgn0014033 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001355352.1 Gene:Mdga1 / 74762 MGIID:1922012 Length:956 Species:Mus musculus


Alignment Length:184 Identity:57/184 - (30%)
Similarity:84/184 - (45%) Gaps:23/184 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DHSCDFESEDQCGWEAETTFRRPWKRVS--TVSDIHSLRTGPRHDHTFKNESGGHYMRMET---- 191
            |::|.||.|..||:..:.|....|.|.:  |.:...|..|||..|.:...|  |:||.:||    
Mouse   751 DNTCHFEDEKICGYTQDLTDNFDWTRQNALTQNPKRSPNTGPPTDISGTPE--GYYMFIETSRPR 813

  Fly   192 QMGAYGSYHLLSPIYPRSLTLKTACCFRFHYFMFGAGVDNLVVSVKPVSMPMATMWNRFRANCSK 256
            ::|  ....|:||:|..|...   .|..|.|.|:|..:.:|.:.|:        ..|:...:...
Mouse   814 ELG--DRARLVSPLYNASAKF---YCVSFFYHMYGKHIGSLNLLVR--------SRNKGTLDTHA 865

  Fly   257 FEISGQQGTQWLEHTISIDEMQEDFQVIFTATDARSQFGDIAIDDVKLMTGSEC 310
            :.:||.:|..|.:..:.|:. ...||:||.........||||||||.|..| ||
Mouse   866 WSLSGNKGNVWQQAHVPINP-SGPFQIIFEGVRGSGYLGDIAIDDVTLKKG-EC 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CINP_477102.1 CCP 22..72 CDD:214478
CCP 77..125 CDD:214478
MAM 131..308 CDD:214533 54/180 (30%)
Somatomedin_B 335..385 CDD:470596
Mdga1NP_001355352.1 Ig 54..115 CDD:472250
Ig strand B 56..60 CDD:409394
Ig strand C 69..73 CDD:409394
Ig strand E 91..95 CDD:409394
Ig strand F 105..110 CDD:409394
Ig_3 132..217 CDD:464046
IG_like 248..326 CDD:214653
Ig strand B 258..262 CDD:409550
Ig strand C 272..276 CDD:409550
Ig strand E 291..295 CDD:409550
Ig strand F 305..310 CDD:409550
Ig strand G 319..322 CDD:409550
Ig 347..418 CDD:472250
Ig strand B 353..357 CDD:409353
Ig strand C 368..372 CDD:409353
Ig strand E 398..402 CDD:409353
Ig strand F 412..417 CDD:409353
Ig_3 439..515 CDD:464046
Ig_3 538..620 CDD:464046
MAM 754..917 CDD:99706 54/179 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..799 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.