DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CI and Mamdc2

DIOPT Version :9

Sequence 1:NP_001285599.1 Gene:Sr-CI / 33621 FlyBaseID:FBgn0014033 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_036017587.1 Gene:Mamdc2 / 71738 MGIID:1918988 Length:689 Species:Mus musculus


Alignment Length:209 Identity:70/209 - (33%)
Similarity:93/209 - (44%) Gaps:31/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QLGSCRRSNH--TRDHSCDFESEDQCGWEAETTFRRPWKRVSTVSDIHSLRTGPRHDHTFKNESG 183
            |||:||....  .....|.|: :|:|.:..|...|..|.|..  .:..:..|||:.|||    :|
Mouse   495 QLGNC
RSPARLPPPPGECTFD-QDECAFTQEKRNRSSWHRGR--GETPTSYTGPKGDHT----TG 552

  Fly   184 -GHYMRMETQMGAYG-SYHLLS-PIYPRSLTLKTACCFRFHYFMFGAGVDNLVVSVK-PVSMPMA 244
             |:||.:|.....|| ..|||| |:  |.:..|.  |..|.|.|:|||...|.|.:| ......:
Mouse   553 VGYYMYIEASHMVYGQKAHLLSQPL--RGVPGKH--CLTFFYHMYGAGTGLLSVYLKREEDSEES 613

  Fly   245 TMWNRFRANCSKFEISGQQGTQWLEHTISIDEMQEDFQVIFTATDARSQFGDIAIDDVKLMTGSE 309
            .:|.|          .|:|...||...:.. ..:...|:||.||...|...|||||||||..| .
Mouse   614 LLWRR----------RGEQSISWLRALVEY-SCRRRHQIIFEATRGVSIRSDIAIDDVKLQAG-P 666

  Fly   310 CGTNGFSTTTEPTA 323
            |.  |...|||.::
Mouse   667 CA--GMEDTTEQSS 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CINP_001285599.1 CCP 22..72 CDD:214478
CCP 77..125 CDD:214478 3/3 (100%)
MAM 131..308 CDD:214533 59/180 (33%)
MAM 136..308 CDD:99706 59/175 (34%)
Somatomedin_B 335..385 CDD:295334
Mamdc2XP_036017587.1 MAM 26..170 CDD:99706
MAM 173..330 CDD:395504
MAM 345..499 CDD:99706 3/3 (100%)
MAM 512..667 CDD:99706 60/177 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8224
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.