Sequence 1: | NP_001285599.1 | Gene: | Sr-CI / 33621 | FlyBaseID: | FBgn0014033 | Length: | 629 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074668.2 | Gene: | Mamdc4 / 381352 | MGIID: | 2685841 | Length: | 1232 | Species: | Mus musculus |
Alignment Length: | 291 | Identity: | 74/291 - (25%) |
---|---|---|---|
Similarity: | 107/291 - (36%) | Gaps: | 79/291 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 VLVGGRTAYCDGERWSTQLGSCRRSNHTRDHSCDFESEDQCGWEAETTFRRPWKRVSTVS-DIHS 167
Fly 168 LRTGPRH-----DHTFKNESGGHYMRMETQM---GAYGSYHLLSPIYPRSLTLKTACCFRFHYFM 224
Fly 225 -----FGAGVDNLVVSVKPVSMPMATMWNRFRANCSKFEISGQQGTQWLEHTISIDEMQEDFQVI 284
Fly 285 FTAT-DARSQFGDIAIDDVKLMTGSECGTNGFSTTTEPTAPTGSNEQP----------LVYDM-- 336
Fly 337 -------------MSCSGRCGTSISASNITN 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sr-CI | NP_001285599.1 | CCP | 22..72 | CDD:214478 | |
CCP | 77..125 | CDD:214478 | 6/20 (30%) | ||
MAM | 131..308 | CDD:214533 | 54/191 (28%) | ||
MAM | 136..308 | CDD:99706 | 53/186 (28%) | ||
Somatomedin_B | 335..385 | CDD:295334 | 7/35 (20%) | ||
Mamdc4 | NP_001074668.2 | MAM | 71..227 | CDD:279023 | |
MAM | 71..224 | CDD:99706 | |||
LDLa | 234..266 | CDD:238060 | |||
MAM | 254..427 | CDD:214533 | |||
MAM | 277..427 | CDD:99706 | |||
LDLa | 462..495 | CDD:238060 | |||
MAM | 498..653 | CDD:279023 | |||
MAM | 499..650 | CDD:99706 | |||
MAM | 660..817 | CDD:214533 | |||
MAM | 665..817 | CDD:99706 | |||
MAM | 823..979 | CDD:279023 | 7/22 (32%) | ||
MAM | 823..977 | CDD:99706 | 6/20 (30%) | ||
MAM | 983..1148 | CDD:279023 | 55/198 (28%) | ||
MAM | 983..1144 | CDD:99706 | 53/186 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |