DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CI and Mdga2

DIOPT Version :9

Sequence 1:NP_001285599.1 Gene:Sr-CI / 33621 FlyBaseID:FBgn0014033 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001180195.2 Gene:Mdga2 / 320772 MGIID:2444706 Length:956 Species:Mus musculus


Alignment Length:209 Identity:61/209 - (29%)
Similarity:88/209 - (42%) Gaps:27/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 HTRDHSCDFESEDQCGWEAETTFRRPWKRVSTV--SDIHSLRTGPRHDHTFKNESGGHYMRMETQ 192
            |.|:..|.||..:.|.:..:.|....|.:.||.  :..::..|||..|.:...|  |.||.:||.
Mouse   742 HLREFHCGFEDGNICLFTQDDTDNFDWTKQSTATRNTKYTPNTGPSADRSGSKE--GFYMYIETS 804

  Fly   193 MGAY--GSYHLLSPIY------PRSLTLKTACCFRFHYFMFG--AGVDNLVVSVKPVSMPMATMW 247
            ....  ....||||::      |...| .:|.||.|.|.|:|  .||.|:.:.:|..:.....:|
Mouse   805 RPRLEGEKARLLSPVFSIAPKNPYGPT-NSAYCFSFFYHMYGQHIGVLNVYLRLKGQTTIENPLW 868

  Fly   248 NRFRANCSKFEISGQQGTQWLEHTISIDEMQEDFQVIFTATDARSQFGDIAIDDVKLMTGSECGT 312
            :.          ||.:|.:|.|..::|..: ..||:||.........||||||||.:..| ||..
Mouse   869 SS----------SGNKGQRWNEAHVNIYPI-TSFQLIFEGIRGPGIEGDIAIDDVSIAEG-ECAK 921

  Fly   313 NGFSTTTEPTAPTG 326
            ....|........|
Mouse   922 QDLPTKNSVDGAVG 935

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CINP_001285599.1 CCP 22..72 CDD:214478
CCP 77..125 CDD:214478
MAM 131..308 CDD:214533 55/188 (29%)
MAM 136..308 CDD:99706 54/183 (30%)
Somatomedin_B 335..385 CDD:295334
Mdga2NP_001180195.2 IG_like 48..128 CDD:214653
IGc2 54..117 CDD:197706
IG_like 154..219 CDD:214653
Ig 155..219 CDD:143165
IG_like 251..328 CDD:214653
IGc2 256..317 CDD:197706
Ig 355..427 CDD:143165
IG_like 451..536 CDD:214653
IGc2 457..522 CDD:197706
Ig_2 543..618 CDD:290606
MAM 748..921 CDD:279023 57/187 (30%)
MAM 748..919 CDD:99706 55/185 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9081
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.