| Sequence 1: | NP_001285599.1 | Gene: | Sr-CI / 33621 | FlyBaseID: | FBgn0014033 | Length: | 629 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_694999.3 | Gene: | MAMDC2 / 256691 | HGNCID: | 23673 | Length: | 686 | Species: | Homo sapiens |
| Alignment Length: | 210 | Identity: | 68/210 - (32%) |
|---|---|---|---|
| Similarity: | 90/210 - (42%) | Gaps: | 37/210 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 121 QLGSCRRSNH--TRDHSCDFESEDQCGWEAETTFRRPWKRVSTVSDIHSLRTGPRHDHTFKNESG 183
Fly 184 -GHYMRMETQMGAYG-SYHLLS-PIYPRSLTLKTACCFRFHYFMFGAGVDNLVVSV-KPVSMPMA 244
Fly 245 TMWNRFRANCSKFEISGQQGTQWLEHTISIDEMQEDFQVIFTATDARSQFGDIAIDDVKLMTGSE 309
Fly 310 CG--------TNGFS 316 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Sr-CI | NP_001285599.1 | CCP | 22..72 | CDD:214478 | |
| CCP | 77..125 | CDD:214478 | 3/3 (100%) | ||
| MAM | 131..308 | CDD:214533 | 57/180 (32%) | ||
| MAM | 136..308 | CDD:99706 | 57/175 (33%) | ||
| Somatomedin_B | 335..385 | CDD:295334 | |||
| MAMDC2 | NP_694999.3 | MAM | 26..167 | CDD:279023 | |
| MAM | 26..167 | CDD:99706 | |||
| MAM | 170..327 | CDD:279023 | |||
| MAM | 170..327 | CDD:99706 | |||
| MAM | 342..497 | CDD:279023 | 4/4 (100%) | ||
| MAM | 342..496 | CDD:99706 | 3/3 (100%) | ||
| MAM | 509..666 | CDD:279023 | 59/179 (33%) | ||
| MAM | 509..664 | CDD:99706 | 58/177 (33%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 521..543 | 6/23 (26%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 665..686 | 3/14 (21%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S8224 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.860 | |||||