DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and Kirrel3

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:873 Identity:188/873 - (21%)
Similarity:299/873 - (34%) Gaps:257/873 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LTLKCRFNDKYEANDFSFFWTRWTANPAQFDNVAIGEVQLSSGYRLDFQPE--------RGIYDL 110
            :||.|...:    .|....|.:        |.:|:|     .|..|...|:        .|.:.|
Mouse    65 VTLLCAIPE----YDGFVLWIK--------DGLALG-----VGRDLSSYPQYLVVGNHLSGEHHL 112

  Fly   111 QIKNVSYNRDNGRFECRIKAKGTGADVHQEFHNLTVLTPPHPPVISPGNIAVATEDKPMELTCSS 175
            :|..... :|:..:||    :...|.:......||||.||..|:|..|.:.......|:.|||.:
Mouse   113 KILRAEL-QDDAVYEC----QAIQAAIRSRPARLTVLVPPDDPIILGGPVISLRAGDPLNLTCHA 172

  Fly   176 IGGSPDPTITWYREG---SNTPLPATVLKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNE 237
            ....|..:|.|.|:|   :......|:|:.| |.:...:||.|.|...::|....|...|:|:..
Mouse   173 DNAKPAASIIWLRKGEVINGATYSKTLLRDG-KRESIVSTLFISPGDVENGQSIVCRATNKAIPG 236

  Fly   238 GKRLEATATLNVNYYPRVEVGPENPLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHT 302
            ||  |.:.|:::.:.|.|.:..| |..|..|......|:..|.|.|...||.:.|..|..: ...
Mouse   237 GK--ETSVTIDI
QHPPLVNLSVE-PQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEA-SGE 297

  Fly   303 IHRVSVQDAGKYT-------CIADNGLGKTGEQELILDILYPPMVVIESKTREAEEGDTVTIRCN 360
            ::|.:|.    ||       |...|.||.|.....: |:.:.|.:..|.::...:.|......|.
Mouse   298 LYRTTVD----YTYFSEPVSCEVTNALGSTNLSRTV-DVYFG
PRMTSEPQSLLVDLGSDAVFSCA 357

  Fly   361 VTANPAPVTIEWLKENSPDFRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERV--GNST 423
            ...||: :||.|:|..|.....|...|||.|||.:.||.|:||||          ..||  |...
Mouse   358 WIGNPS-LTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAV----------VPRVGAGERE 411

  Fly   424 VALLVRHRP---------------GQ--AYITPNKP------------------------VVHVG 447
            |.|.|...|               ||  .:|....|                        .|:..
Mouse   412 VTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETVNTE 476

  Fly   448 NGV--TLTCS----------ANPPGWPVPQYRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEG 500
            .||  |||.|          .|...|            ..|.|..:|:....|.|..|:..|.|.
Mouse   477 EGVISTLTISNIVRADFQTIYNCTAW------------NSFGSDTEIIRLKEQGSEMKSGAGLEA 529

  Fly   501 KYHCHAV---NELGIG-----MMATIVLEIHQPPQFLAKLQQHMTRRVADTDYTVTCSAKGKPAP 557
            :....||   ..:|.|     :|||||       .|.....|.              |..|:|  
Mouse   530 ESVPMAVIIGVAVGAGVAFLVLMATIV-------AFCCARSQR--------------STGGRP-- 571

  Fly   558 SVKWLKDAVEILPEENLYEVQTNPDQGLNGMVTVQSQLKFRGKARPNGNALVPGDRGLYTCLYQN 622
                                      |::|..| :.:.:.|...|.|...:|.....:...:...
Mouse   572 --------------------------GISGRGT-EKKARLRLPRRANLKGVVSAKNDIRVEIVHK 609

  Fly   623 EVNSANSSMQLRIEHEPIVLHQYNKVAFDIRETAEVVCKVQAYPKPEFQWQFGNNPSPLTMSSDG 687
            |.:|...:.    :|..|.....::..|   :...|:.:::...:.|.::|...:|      ::|
Mouse   610 EPSSGREAE----DHTTIKQLMMDRGEF---QQDSVLKQLEVLKEEEKEFQNLKDP------TNG 661

  Fly   688 HYEISTTTDNNDIYTSVLKINSLTHSDYGEYTCRVANTLDTIRAPIRLQQKGPPEKPTNLRATEV 752
            :|.::|..:::.  |..:.::|          |:.           .|:..|....||.:..|.:
Mouse   662 YYSVNTFKEHHS--TPTISLSS----------CQP-----------DLRPTGKQRVPTGMSFTNI 703

  Fly   753 GHNYVSLS-----WDPG--FDGGLSKTKFFVSYRRVAMPREEQLIPDCATLANSNSAWVEVDC-- 808
               |.:||     :|.|  |..|:..:...:..|....          .:|::| |::::..|  
Mouse   704 ---YSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQR----------GSLSDS-SSFLDTQCDS 754

  Fly   809 ------------QRDIPCKVTALEQHQS 824
                        |.|...|.:|...|.|
Mouse   755 SVSSSGKQDGYVQFDKASKASASSSHHS 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845 20/100 (20%)
I-set 146..249 CDD:254352 32/105 (30%)
Ig 168..249 CDD:299845 25/83 (30%)
IGc2 268..323 CDD:197706 15/61 (25%)
Ig_3 341..406 CDD:290638 23/64 (36%)
Ig_2 437..514 CDD:290606 23/120 (19%)
I-set 526..633 CDD:254352 14/106 (13%)
Ig 546..632 CDD:143165 12/85 (14%)
IG_like 654..736 CDD:214653 10/81 (12%)
Ig 656..734 CDD:143165 10/77 (13%)
FN3 741..848 CDD:238020 21/105 (20%)
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653 19/99 (19%)
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353 3/5 (60%)
Ig strand C 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 1/3 (33%)
Ig strand E 104..116 CDD:409353 3/11 (27%)
Ig strand G 132..143 CDD:409353 2/10 (20%)
IgI_2_KIRREL3-like 149..246 CDD:409416 28/99 (28%)
Ig strand B 166..170 CDD:409416 1/3 (33%)
Ig strand C 180..184 CDD:409416 1/3 (33%)
Ig strand E 210..214 CDD:409416 2/3 (67%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 1/2 (50%)
Ig <267..334 CDD:416386 18/72 (25%)
Ig strand B 267..274 CDD:409353 1/6 (17%)
Ig strand C 279..286 CDD:409353 3/6 (50%)
Ig strand C' 288..291 CDD:409353 1/2 (50%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 2/9 (22%)
Ig strand G 321..334 CDD:409353 3/13 (23%)
Ig 335..416 CDD:416386 30/91 (33%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 3/5 (60%)
Ig strand E 381..387 CDD:409353 3/5 (60%)
IgI_5_KIRREL3 418..515 CDD:409479 17/108 (16%)
Ig strand B 436..440 CDD:409479 2/3 (67%)
Ig strand C 450..454 CDD:409479 0/3 (0%)
Ig strand E 481..485 CDD:409479 2/3 (67%)
Ig strand F 496..501 CDD:409479 1/4 (25%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.