DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and NECTIN1

DIOPT Version :10

Sequence 1:NP_523469.2 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_002846.3 Gene:NECTIN1 / 5818 HGNCID:9706 Length:517 Species:Homo sapiens


Alignment Length:332 Identity:87/332 - (26%)
Similarity:124/332 - (37%) Gaps:83/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DLTLKCRF-NDKYEANDFSFFWTRWTANPAQFDNVAIGEVQLSSGYRLDFQPERGIYDL--QIKN 114
            |:.|.|.| |...........|.:.|....|  ||||            :.|..|:..|  ..:.
Human    46 DVVLHCSFANPLPSVKITQVTWQKSTNGSKQ--NVAI------------YNPSMGVSVLAPYRER 96

  Fly   115 VSYNR----------------DNGRFECRIKAKGTGADVHQEFHNLTVLTPPHPPVISPGNIAV- 162
            |.:.|                |.|.:.|......||....|  .||||:..|...:  .|..|| 
Human    97 VEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQ--LNLTVM
AKPTNWI--EGTQAVL 157

  Fly   163 ----ATEDKPMELTCSSIGGSPDPTITWYREGSNTPLPATVLKGGTKDQP---TNATLSII---- 216
                ..:||.:..||:|..|.|...::|          .|.|||..:.|.   .|.|:::|    
Human   158 RAKKGQDDKVLVATCTSANGKPPSVVSW----------ETRLKGEAEYQEIRNPNGTVTVISRYR 212

  Fly   217 --PRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPRVEV-GPENPLRVERDRTAKLECNVD 278
              |.||.......|:| |..|:   |.:.:.||||.|.|.|.: |.:....::| ...||.|..|
Human   213 LVPSREAHQQSLACIV-NYHMD---RFKESLTLNV
QYEPEVTIEGFDGNWYLQR-MDVKLTCKAD 272

  Fly   279 AKPKVPNVRWNRNGRFISSSL---VHTIHR-------VSVQDAGKYTCIADNGLG-KTGEQEL-I 331
            |.|......|..    ::.||   |...:|       ::...||.|.|.|.|.:| ::|:.|: |
Human   273 ANPPATEYHWTT----LNGSLPKGVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSGQVEVNI 333

  Fly   332 LDILYPP 338
            .:..|.|
Human   334 TEFPYTP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_523469.2 V-set 50..147 CDD:462230 26/112 (23%)
Ig 153..249 CDD:472250 29/109 (27%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 183..187 CDD:409353 0/3 (0%)
Ig strand E 211..215 CDD:409353 1/3 (33%)
Ig strand F 225..230 CDD:409353 1/4 (25%)
Ig strand G 242..245 CDD:409353 0/2 (0%)
Ig_3 253..320 CDD:464046 20/77 (26%)
Ig_3 337..406 CDD:464046 1/2 (50%)
Ig_2 437..>504 CDD:464026
Ig 525..635 CDD:472250
Ig strand B 545..549 CDD:409568
Ig strand C 558..562 CDD:409568
Ig strand E 587..591 CDD:409568
Ig strand F 615..620 CDD:409568
Ig strand G 628..631 CDD:409568
Ig_3 639..724 CDD:464046
FN3 741..848 CDD:238020
NECTIN1NP_002846.3 IgV_1_Nectin-1_like 31..143 CDD:409469 26/112 (23%)
FR1 31..54 CDD:409469 3/7 (43%)
Ig strand A 31..35 CDD:409469
Ig strand A' 37..41 CDD:409469
Ig strand B 46..54 CDD:409469 3/7 (43%)
CDR1 55..62 CDD:409469 1/6 (17%)
FR2 63..69 CDD:409469 1/5 (20%)
Ig strand C 64..69 CDD:409469 1/4 (25%)
CDR2 70..89 CDD:409469 8/32 (25%)
Ig strand C' 79..84 CDD:409469 2/16 (13%)
Ig strand C' 86..90 CDD:409469 1/3 (33%)
FR3 90..128 CDD:409469 6/37 (16%)
Ig strand D 97..101 CDD:409469 1/3 (33%)
Ig strand E 106..113 CDD:409469 0/6 (0%)
Ig strand F 120..128 CDD:409469 2/7 (29%)
CDR3 129..132 CDD:409469 0/2 (0%)
Ig strand G 132..142 CDD:409469 4/11 (36%)
FR4 133..143 CDD:409469 4/11 (36%)
IgC1_2_Nectin-1_like 146..243 CDD:143298 30/112 (27%)
Ig strand A 146..152 CDD:143298 1/7 (14%)
Ig strand B 168..175 CDD:143298 2/6 (33%)
Ig strand C 180..186 CDD:143298 1/15 (7%)
Ig strand C' 188..190 CDD:143298 0/1 (0%)
Ig strand D 191..199 CDD:143298 2/7 (29%)
Ig strand E 205..213 CDD:143298 1/7 (14%)
Ig strand F 223..230 CDD:143298 2/7 (29%)
Ig strand G 234..240 CDD:143298 1/5 (20%)
Ig 247..333 CDD:472250 24/90 (27%)
Ig strand B 265..269 CDD:409353 2/3 (67%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Interaction with FGFR. /evidence=ECO:0000250|UniProtKB:Q9JKF6 282..299 4/20 (20%)
Ig strand E 298..302 CDD:409353 1/3 (33%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
Ig strand G 330..333 CDD:409353 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.