DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and tei

DIOPT Version :10

Sequence 1:NP_523469.2 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster


Alignment Length:524 Identity:119/524 - (22%)
Similarity:177/524 - (33%) Gaps:182/524 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LQIKNVSYNRDNGRFECRIKAKGTGADVHQEFHN-----LTVLTPPHPPV-------ISPGNIAV 162
            |.|.||.. .|:|:::|  :|:.|    .:...|     |.||..|.||.       :...|:.|
  Fly   298 LTITNVML-EDDGKWQC--EAENT----RRYTENARPVKLVVLDRPKPPYLLIDSRRLDASNLFV 355

  Fly   163 -ATEDKPMELTCSSIGGSPDPTITWYREGSNTPLPATVLKGGTKDQPTNATLSIIPRREDDGAK- 225
             ..|:..:.|.|.|.||:|.||:||          ..:|..|........:..::...|..|.| 
  Fly   356 PVKENSELNLACVSEGGNPRPTLTW----------EVLLSPGVDRHAQKVSAEVLELEEIKGEKL 410

  Fly   226 ----YKCVVRNRAMNEGKRLEATATLNVNYYPRVEVGPENPLRVERDRTAKLECNVDAKPKVPNV 286
                ||       :|.|.:.||                                      ::|.|
  Fly   411 DKDGYK-------INSGAKSEA--------------------------------------RLPAV 430

  Fly   287 -RWNRNGRFISSSLVHTIHRVSVQDAGKYTCIADNGLGKTGEQ-ELILDILYPPMVVIESKT--- 346
             |.:.|.|.:                    |:.::...|..:. .|:||:.|.|...| |:|   
  Fly   431 YRAHHNARIL--------------------CVMEHPTLKIRQNASLLLDVQYTPSFAI-SRTPGF 474

  Fly   347 -REAEEGDTVTIRCNVTANPAPVTIEWLKE--NSPDFRYNGDVLTLTSVRADHAGNYIC--RAVN 406
             ....||..|:::|:|.:|| |.|..|.|:  ::|..:.....|..||:|.:|:|.|.|  |.:|
  Fly   475 GYPLREGIEVSLKCDVDSNP-PSTPRWQKDDGDTPVPQTGDGFLNFTSIRREHSGWYKCTSRHLN 538

  Fly   407 IMQSQ-GMERSERVGNSTV----------ALLVRHRPGQAYITPNKPVVHVGNGVTLTCSANPPG 460
            ...|. |...|.|..:..|          .....|.|.:..:.     |.:|..|||.|.....|
  Fly   539 FQYSSIGYYLSVRFDSVDVTSEPDDQDVSVAAASHNPNKGQLE-----VQLGGAVTLQCPQGSLG 598

  Fly   461 -W----PVPQYRWFRDMDGEFSSTQKILAQGP-----QYSIPKAHLGNEGKYHCHAVNELGIGMM 515
             |    |:             |:..:.|..|.     |:|:......:.|.|.|           
  Fly   599 CWSHLDPI-------------SARLRGLGYGSSQPTGQFSLKDVMYQDAGMYKC----------- 639

  Fly   516 ATIVLEIHQPPQFLAKLQQHMTRRVADTDYTVTCSAKGKPAPSVKWLKDAVEILPEENLY---EV 577
                  :.|.|....||         :...:||.|.||  ||:|..|.......|...|:   |.
  Fly   640 ------VGQSPTNKKKL---------EVLQSVTVSVKG--APTVMALNATPVAYPGSPLHLNVEF 687

  Fly   578 QTNP 581
            ..||
  Fly   688 CANP 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_523469.2 V-set 50..147 CDD:462230 11/41 (27%)
Ig 153..249 CDD:472250 25/108 (23%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 183..187 CDD:409353 2/3 (67%)
Ig strand E 211..215 CDD:409353 0/3 (0%)
Ig strand F 225..230 CDD:409353 3/9 (33%)
Ig strand G 242..245 CDD:409353 2/2 (100%)
Ig_3 253..320 CDD:464046 6/67 (9%)
Ig_3 337..406 CDD:464046 25/76 (33%)
Ig_2 437..>504 CDD:464026 16/76 (21%)
Ig 525..635 CDD:472250 17/60 (28%)
Ig strand B 545..549 CDD:409568 1/3 (33%)
Ig strand C 558..562 CDD:409568 1/3 (33%)
Ig strand E 587..591 CDD:409568
Ig strand F 615..620 CDD:409568
Ig strand G 628..631 CDD:409568
Ig_3 639..724 CDD:464046
FN3 741..848 CDD:238020
teiNP_523731.2 IG_like 244..332 CDD:214653 11/40 (28%)
Ig strand B 254..258 CDD:409353
Ig strand C 267..271 CDD:409353
Ig strand E 296..300 CDD:409353 1/1 (100%)
Ig strand F 310..315 CDD:409353 1/6 (17%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 29/167 (17%)
Ig_3 478..533 CDD:464046 19/55 (35%)
IG_like 578..660 CDD:214653 23/125 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.