DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and Kirrel3

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_038937320.1 Gene:Kirrel3 / 315546 RGDID:1311382 Length:869 Species:Rattus norvegicus


Alignment Length:868 Identity:187/868 - (21%)
Similarity:307/868 - (35%) Gaps:230/868 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LTLKCRFNDKYEANDFSFFWTRWTANPAQFDNVAIGEVQLSSGYRLDFQPE--------RGIYDL 110
            :||.|...:    .|....|.:        |.:|:|     .|..|...|:        .|.:.|
  Rat    65 VTLLCAIPE----YDGFVLWIK--------DGLALG-----VGRDLSSYPQYLVVGNHLSGEHHL 112

  Fly   111 QIKNVSYNRDNGRFECRIKAKGTGADVHQEFHNLTVLTPPHPPVISPGNIAVATEDKPMELTCSS 175
            :|..... :|:..:||    :...|.:......||||.||..|:|..|.:.......|:.|||.:
  Rat   113 KILRAEL-QDDAVYEC----QAIQAAIRSRPARLTVLVPPDDPIILGGPVISLRAGDPLNLTCHA 172

  Fly   176 IGGSPDPTITWYREG---SNTPLPATVLKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNE 237
            ....|..:|.|.|:|   :......|:|:.| |.:...:||.|.|...::|....|...|:|:..
  Rat   173 DNAKPAASIIWLRKGEVINGATYSKTLLRDG-KRESIVSTLFISPGDVENGQSIVCRATNKAIPG 236

  Fly   238 GKRLEATATLNVNYYPRVEVGPENPLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHT 302
            ||  |.:.|:::.:.|.|.:..| |..|..|......|:..|.|.|...||.:.|..|..: ...
  Rat   237 GK--ETSVTIDI
QHPPLVNLSVE-PQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEA-SGE 297

  Fly   303 IHRVSVQDAGKYT-------CIADNGLGKTGEQELILDILYPPMVVIESKTREAEEGDTVTIRCN 360
            ::|.:|.    ||       |...|.||.|.....: |:.:.|.:..|.::...:.|......|.
  Rat   298 LYRTTVD----YTYFSEPVSCEVTNALGSTNLSRTV-DVYFG
PRMTSEPQSLLVDLGSDAVFSCA 357

  Fly   361 VTANPAPVTIEWLKENSPDFRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERV--GNST 423
            ...||: :||.|:|..|.....|...|||.|||.:.||.|:||||          ..||  |...
  Rat   358 WIGNPS-LTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAV----------VPRVGAGERE 411

  Fly   424 VALLVRHRPGQAYITPNKPVVHVGNGVTLTC---SANPPGWPVPQYRWFRDMDGEFSSTQKILAQ 485
            |.|.| :.|.....|..:..:| |....:.|   |..||    .:..|        |..:.:|..
  Rat   412 VTLTV-NGPPIISSTQTQHALH-GEKGQIKCFIRSTPPP----DRIAW--------SWKENVLES 462

  Fly   486 GPQYSIPKAHLGNEGKYHCHAVNELGIGMMATIVLEIHQPPQFLAKLQQHMTRRVADTDYTVTC- 549
                       |..|:|....|| ...|:::|:.:             .::.|....|.|..|. 
  Rat   463 -----------GTSGRYTVETVN-TEEGVISTLTI-------------SNIVRADFQTIYNCTAW 502

  Fly   550 SAKGKPAPSVKWLKDAVEILPEENLYEVQTNPDQGLNG------------MVTVQSQLKFRGKAR 602
            ::.|.....::..:...|:.....| |.::.|...:.|            |.|:.:....|.:..
  Rat   503 NSFGSDTEIIRLKEQGSEMKSGAGL-EAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRS 566

  Fly   603 PNGNALVPGDRG--------LYTCLYQNEVNSANSSMQLRIEH-EPIVLHQ------YNKVAFDI 652
            ..|...:.| ||        |........|.||.:.:::.|.| ||....:      ..::..|.
  Rat   567 TGGRPGISG-RGTEQKARLRLPRRANLKGVVSAKNDIRVEIVHKEPASGREAEDHTTIKQLMMDR 630

  Fly   653 RETAE--VVCKVQAYPKPEFQWQFGNNPSPLTMSSDGHYEISTTTDNNDIYTSVLKINSLTHSDY 715
            .|..:  |:.:::...:.|.::|...:|      ::|:|.::|..:::.  |..:.::|      
  Rat   631 GEFQQDSVLKQLEVLKEEEKEFQNLKDP------TNGYYSVNTFKEHHS--TPTISLSS------ 681

  Fly   716 GEYTCRVANTLDTIRAPIRLQQKGPPEKPTNLRATEVGHNYVSLSWDPG-FDGGLSKTKFFVSYR 779
                |:.           .|:..|....||.:..|.:   |.:||.... :|.|.|.|       
  Rat   682 ----CQP-----------DLRPTGKQRVPTGMSFTNI---YSTLSGQGRLYDYGQSVT------- 721

  Fly   780 RVAMPREEQLIPDCATLANSNSAWVEVDCQRDIPCKVTALEQHQSYAFKVKALNPKSDSPYSSEI 844
                         .|:.|.:|         :...|.:                            
  Rat   722 -------------AASAAAAN---------KMATCSL---------------------------- 736

  Fly   845 MVTTKVSRIPPPLQVTYEPNTRT 867
               |:.:|:.|||..|..|..||
  Rat   737 ---TRPARLLPPLPTTPSPLPRT 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845 20/100 (20%)
I-set 146..249 CDD:254352 32/105 (30%)
Ig 168..249 CDD:299845 25/83 (30%)
IGc2 268..323 CDD:197706 15/61 (25%)
Ig_3 341..406 CDD:290638 23/64 (36%)
Ig_2 437..514 CDD:290606 15/79 (19%)
I-set 526..633 CDD:254352 21/127 (17%)
Ig 546..632 CDD:143165 18/106 (17%)
IG_like 654..736 CDD:214653 11/83 (13%)
Ig 656..734 CDD:143165 10/79 (13%)
FN3 741..848 CDD:238020 14/107 (13%)
Kirrel3XP_038937320.1 IG_like 54..143 CDD:214653 19/99 (19%)
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353 3/5 (60%)
Ig strand C 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 1/3 (33%)
Ig strand E 104..116 CDD:409353 3/11 (27%)
Ig strand G 132..143 CDD:409353 2/10 (20%)
IgI_2_KIRREL3-like 149..246 CDD:409416 28/99 (28%)
Ig strand B 166..170 CDD:409416 1/3 (33%)
Ig strand C 180..184 CDD:409416 1/3 (33%)
Ig strand E 210..214 CDD:409416 2/3 (67%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 1/2 (50%)
Ig <267..334 CDD:416386 18/72 (25%)
Ig strand B 267..274 CDD:409353 1/6 (17%)
Ig strand C 279..286 CDD:409353 3/6 (50%)
Ig strand C' 288..291 CDD:409353 1/2 (50%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 2/9 (22%)
Ig strand G 321..334 CDD:409353 3/13 (23%)
Ig 335..416 CDD:416386 30/91 (33%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 3/5 (60%)
Ig strand E 381..387 CDD:409353 3/5 (60%)
IgI_5_KIRREL3 418..515 CDD:409479 23/134 (17%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/11 (9%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 1/4 (25%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.