DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and Hmcn1

DIOPT Version :10

Sequence 1:NP_523469.2 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_001258221.1 Gene:Hmcn1 / 289094 RGDID:1564772 Length:5635 Species:Rattus norvegicus


Alignment Length:1262 Identity:275/1262 - (21%)
Similarity:445/1262 - (35%) Gaps:302/1262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LADESIDTRENADLTLKCRFNDKYEANDFSFFWTRWTANPAQFD-NVAIGEVQLSSGYRLDFQPE 104
            :..|.|...:.:..::.| |.|  .|...|..|.| ...|...| ::.||              .
  Rat  3440 MGTEEITLVKGSSTSMTC-FTD--GAPTPSMSWLR-DGQPLALDAHLTIG--------------T 3486

  Fly   105 RGIYDLQIKNVSYNRDNGRFECRIKAKGTGADVHQEFHNLTVLTPPHPPVIS----PGNIAVATE 165
            :|:....||  :...|.|::.|  .|.....:|.:.| .|.||.|||   |:    ||.::|.. 
  Rat  3487 QGMVLQLIK--ADTEDTGKYTC--VASNEAGEVSKHF-VLKVLEPPH---INGSEGPGEVSVIV- 3542

  Fly   166 DKPMELTCSSIGGSPDPTITWYREGSNTPLPAT----VLKGGTKDQPTNATLSIIPRREDDGAKY 226
            :.|:||:|.: .|.|.|.|:|.::|  .|...|    .|:||       |.|.:...:.:|..:|
  Rat  3543 NNPLELSCIA-SGIPAPKISWMKDG--RPFLQTEQVQTLEGG-------AILRVSSAQVEDTGRY 3597

  Fly   227 KCVVRNRAMNEGKRLEATATLNVNYYPRVEVGPE-------NPLRVERDRTAKLECNVDAKPKVP 284
            .|:..:.|.::.|          .|..||.|.|.       ....|.|:|...|||..||.|. |
  Rat  3598 TCLASSPAGDDDK----------EYLVRVHVPPNIAGVDEAQDFTVLRNRQVTLECKSDAVPP-P 3651

  Fly   285 NVRWNRNG---------RFISSSLVHTIHRVSVQDAGKYTCIADNGLGKTGEQELILDILYPPMV 340
            .:.|.:||         |.:|......|:...:.|...|||:|.|..||| .:|.||.:..||.:
  Rat  3652 VIMWLKNGEQLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKT-TREFILTVNVPPSI 3715

  Fly   341 VIESKTREAEEGDTVTIRCNVTANPAPVTIEWLKEN----SPDFRY----NGDVLTLTSVRADHA 397
            ....::.......::.:.|.....|:| .|.|.|:.    ....||    || .|.:.|......
  Rat  3716 SGGPQSLVTLLNKSIALECLAEGVPSP-RITWRKDGVVLAESHARYSILENG-FLHIQSAHITDT 3778

  Fly   398 GNYICRAVNIMQSQGMERSERVGNSTVALLVRHRPGQAYITPNKPVVHVGNGVTLTCSANPPGWP 462
            |.|:|.|.|:   .|.:| .|:.      |..|.|......|....|.|....||.|.|.  |.|
  Rat  3779 GRYLCMATNV---AGTDR-RRID------LQVHVPPSIAAGPTNVTVTVNVQTTLACEAT--GIP 3831

  Fly   463 VPQYRWFRD-----MDGEFSSTQKILAQGPQYSIPKAHLGNEGKYHCHAVNELGIGMMATIVLEI 522
            .|...|.:|     :| :..::.::|:.|....|..: :.:...|.|...::.|.. ..|:.|.:
  Rat  3832 KPSINWRKDGHLLNVD-QNQNSYRLLSSGSLIIISPS-VDDTASYECTVTSDAGED-KRTVDLTV 3893

  Fly   523 HQPPQFLAKLQQHMTRRVADTDYTVTCSAKGKPAPSVKWLKDAVEILPEENLYEVQTNPDQGLNG 587
            ..||....:....:..|.|..  .:||||.|.|.||:.|.|:.:.:||..:.|.:.:      :|
  Rat  3894 QVPPTIADEPMDFLVTRQAPA--VMTCSASGVPLPSIHWTKNGIRLLPRGDGYRILS------SG 3950

  Fly   588 MVTVQ-SQLKFRGKARPNGNALVPGDRGLYTCLYQNEVNSANSSMQLRIEHEPIVLHQYNKVAFD 651
            .:.:. :||...|:               |||:.:|...|.:..:.||::..|.:..|.:::...
  Rat  3951 AIEISAAQLNHAGR---------------YTCIARNAAGSVHRHVTLRVQEPPFIQPQPSELDVI 4000

  Fly   652 IRETAEVVCKVQAYPKPEFQWQFGNNPSPLTMSSDGHYEISTTTDNNDIYTSVLKINSLTHSDYG 716
            :.....:.|:....|.|...||           .:|...|::......:.:..|:|:.....|.|
  Rat  4001 LNNPILLPCEATGIPTPFITWQ-----------KEGINVITSGKSLAVLPSGSLQISRAVQGDAG 4054

  Fly   717 EYTCRVANTLDTIRAPIRLQQKGPPEKPTNLRATEVGHNYVSLSWDPGFDGGLSKTKFFVSYRRV 781
            .|.|...|...|....|:|..:.||                ::|         |..|.:|    |
  Rat  4055 TYMCVAQNPAGTALGKIKLNVQVPP----------------AIS---------SHQKEYV----V 4090

  Fly   782 AMPREEQLIPDCATLANSNSAWVEVDCQRDIPCKVTALEQH--QSYAFKVKALNPKSDSPYS--- 841
            .|.:...|:  |.|   ..|...::...:|......::.|.  .|.|.::....|.....|:   
  Rat  4091 TMDKPVSLL--CET---EGSPPPDITWHKDGHALTESIRQRILNSGALQIAFAQPDDAGQYTCMA 4150

  Fly   842 -----SEIMVTTKVSRIPPPLQVTYEPNTRTLGIDVGATCLNLVAVVESMVNAD---SPMAAWEV 898
                 |..|.||....:||.:|.|....|......|...|:           ||   :|...|| 
  Rat  4151 ANMAGSSSMSTTLTVHVPPRIQSTEVHYTVNENSQVVLPCV-----------ADGIPTPAIHWE- 4203

  Fly   899 VTTMDNLQLSGNGPTHKEKIIDRIIGARRVGGGRALGHTISEDEDDNGLNSLALEDENSPTVRVK 963
               .|::.|:                       ..||...::...:..|.::.|||..:.|    
  Rat  4204 ---RDSVLLA-----------------------NLLGKYTAQPYGELVLENVVLEDAGTYT---- 4238

  Fly   964 LCLRTNPEHCGDYTDAEIGRPYIAEANALATPTLIAIIVSCVVFALFAGLILMFCRCKRNQSKKS 1028
             |:..|                   |....|.|:...:.:...|....|.:.:   .|..|.:.|
  Rat  4239 -CVANN-------------------AAGEDTHTVTLTVHALPTFTELPGDLSL---NKGEQLRLS 4280

  Fly  1029 AAAKDYEMDSVRPSIVAAQQNQAPPPYYPA-SGLDNKALEHSMDLALSMEDQKTALYATQNGYSY 1092
            ..|....:    |.:.....|...|.::.: :|.....:|     .:|.||..|.:...:|...:
  Rat  4281 CKAVGIPL----PKLTWTFNNNIIPAHFDSVNGHSELVIE-----KVSKEDSGTYVCTAENSVGF 4336

  Fly  1093 HPGSGVVGVGMGGGVVGVGVGGSVVSG--MGGGVGGIGGSGV---GVNGIPGLSAHTMPGNEWVN 1152
            ....|.|.|          ....|..|  ....:..:||:.:   .|.|.|.      |..:|..
  Rat  4337 VKAIGFVYV----------KEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPA------PTIQWSR 4385

  Fly  1153 MG---YMENNYSNSNNG-----GSVNSQDSLWQVKMSAAAVGNQQGMVQAPMNQYVEQQPAYGYD 1209
            .|   .:.:......||     |:||.....:     .....|:.|:|:..|:..::..|....:
  Rat  4386 KGADVEISHRIRQLGNGSLAIYGTVNEDAGDY-----TCVAANEAGVVERSMSLTLQSSPMITLE 4445

  Fly  1210 P----LTHGGYGAVDDYA---PYPHLT 1229
            |    :..||...:|..|   |.|.:|
  Rat  4446 PVETIVDAGGRVTLDCQAAGEPQPTIT 4472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_523469.2 V-set 50..147 CDD:462230 21/97 (22%)
Ig 153..249 CDD:472250 26/103 (25%)
Ig strand B 169..173 CDD:409353 2/3 (67%)
Ig strand C 183..187 CDD:409353 1/3 (33%)
Ig strand E 211..215 CDD:409353 2/3 (67%)
Ig strand F 225..230 CDD:409353 2/4 (50%)
Ig strand G 242..245 CDD:409353 0/2 (0%)
Ig_3 253..320 CDD:464046 25/82 (30%)
Ig_3 337..406 CDD:464046 18/76 (24%)
Ig_2 437..>504 CDD:464026 17/71 (24%)
Ig 525..635 CDD:472250 27/110 (25%)
Ig strand B 545..549 CDD:409568 0/3 (0%)
Ig strand C 558..562 CDD:409568 1/3 (33%)
Ig strand E 587..591 CDD:409568 1/3 (33%)
Ig strand F 615..620 CDD:409568 3/4 (75%)
Ig strand G 628..631 CDD:409568 0/2 (0%)
Ig_3 639..724 CDD:464046 15/84 (18%)
FN3 741..848 CDD:238020 19/116 (16%)
Hmcn1NP_001258221.1 ChlD <30..210 CDD:440853
Ig 520..608 CDD:472250
Ig strand B 537..541 CDD:409353
Ig strand C 550..554 CDD:409353
Ig strand E 574..578 CDD:409353
Ig strand F 588..593 CDD:409353
Ig strand G 601..604 CDD:409353
I-set 612..696 CDD:400151
Ig strand B 629..633 CDD:409353
Ig strand C 642..646 CDD:409353
Ig strand E 665..668 CDD:409353
Ig strand F 678..683 CDD:409353
Ig strand G 693..696 CDD:409353
I-set 702..789 CDD:400151
Ig strand B 720..723 CDD:409353
Ig strand C 732..736 CDD:409353
Ig strand E 755..759 CDD:409353
Ig strand F 769..774 CDD:409353
Ig 793..884 CDD:472250
Ig strand B 810..814 CDD:409570
Ig strand C 823..829 CDD:409570
Ig strand E 850..854 CDD:409570
Ig strand F 864..869 CDD:409570
Ig strand G 877..880 CDD:409570
Ig 890..977 CDD:472250
Ig strand B 907..911 CDD:409353
Ig strand C 921..925 CDD:409353
Ig strand F 957..962 CDD:409353
Ig strand G 970..973 CDD:409353
Ig 980..1071 CDD:472250
Ig strand B 998..1002 CDD:409353
Ig strand C 1011..1015 CDD:409353
Ig strand E 1035..1038 CDD:409353
Ig strand F 1048..1053 CDD:409353
Ig strand G 1061..1064 CDD:409353
I-set 1085..1167 CDD:400151
Ig strand B 1097..1101 CDD:409353
Ig strand C 1110..1114 CDD:409353
Ig strand E 1133..1137 CDD:409353
Ig strand F 1147..1152 CDD:409353
Ig strand G 1160..1163 CDD:409353
I-set 1171..1258 CDD:400151
Ig strand B 1188..1192 CDD:409353
Ig strand C 1201..1205 CDD:409353
Ig strand E 1224..1228 CDD:409353
Ig strand F 1238..1243 CDD:409353
Ig strand G 1251..1254 CDD:409353
Ig 1262..1355 CDD:472250
Ig strand B 1284..1288 CDD:409570
Ig strand C 1297..1301 CDD:409570
Ig strand E 1320..1324 CDD:409570
Ig strand F 1335..1340 CDD:409570
Ig strand G 1348..1351 CDD:409570
I-set 1368..1448 CDD:400151
Ig strand B 1378..1382 CDD:409353
Ig strand C 1391..1395 CDD:409353
Ig strand E 1414..1418 CDD:409353
Ig strand F 1428..1433 CDD:409353
Ig strand G 1441..1444 CDD:409353
Ig_3 1451..1529 CDD:464046
I-set 1563..1633 CDD:400151
Ig strand B 1565..1569 CDD:409353
Ig strand C 1578..1582 CDD:409353
Ig strand E 1601..1605 CDD:409353
Ig strand F 1615..1620 CDD:409353
I-set 1645..1729 CDD:400151
Ig strand B 1659..1663 CDD:409353
Ig strand C 1672..1676 CDD:409353
Ig strand E 1694..1699 CDD:409353
Ig strand F 1709..1714 CDD:409353
I-set 1752..1822 CDD:400151
Ig strand C 1765..1769 CDD:409353
Ig strand E 1788..1792 CDD:409353
Ig strand F 1802..1807 CDD:409353
IG_like 1834..1915 CDD:214653
Ig strand B 1844..1848 CDD:409568
Ig strand C 1857..1861 CDD:409568
Ig strand E 1881..1885 CDD:409568
Ig strand F 1895..1900 CDD:409568
Ig strand G 1908..1911 CDD:409568
Ig 1928..2000 CDD:472250
Ig strand B 1938..1942 CDD:409353
Ig strand C 1951..1955 CDD:409353
Ig strand E 1974..1978 CDD:409353
Ig strand F 1988..1993 CDD:409353
Ig_3 2011..2087 CDD:464046
I-set 2111..2191 CDD:400151
Ig strand B 2121..2125 CDD:409570
Ig strand C 2134..2138 CDD:409570
Ig strand E 2156..2160 CDD:409570
Ig strand F 2171..2176 CDD:409570
Ig strand G 2184..2187 CDD:409570
Ig_3 2194..2273 CDD:464046
Ig_3 2297..2367 CDD:464046
I-set 2392..2474 CDD:400151
Ig strand B 2404..2408 CDD:409568
Ig strand C 2417..2421 CDD:409568
Ig strand E 2438..2444 CDD:409568
Ig strand F 2454..2459 CDD:409568
I-set 2478..2567 CDD:400151
Ig strand B 2497..2501 CDD:409353
Ig strand C 2510..2514 CDD:409353
Ig strand E 2533..2537 CDD:409353
Ig strand F 2547..2552 CDD:409353
I-set 2582..2663 CDD:400151
Ig strand B 2593..2597 CDD:409353
Ig strand C 2606..2610 CDD:409353
Ig strand E 2629..2633 CDD:409353
Ig strand F 2643..2648 CDD:409353
Ig strand G 2656..2659 CDD:409353
I-set 2681..2762 CDD:400151
Ig strand B 2692..2696 CDD:409353
Ig strand C 2705..2709 CDD:409353
Ig strand E 2727..2732 CDD:409353
Ig strand F 2742..2747 CDD:409353
I-set 2789..2858 CDD:400151
Ig strand B 2795..2799 CDD:409353
Ig strand C 2808..2812 CDD:409353
Ig strand E 2831..2835 CDD:409353
Ig strand F 2845..2850 CDD:409353
I-set 2879..2960 CDD:400151
Ig strand B 2890..2894 CDD:409353
Ig strand C 2903..2907 CDD:409353
Ig strand E 2925..2930 CDD:409353
Ig strand F 2940..2945 CDD:409353
I-set 2982..3052 CDD:400151
Ig strand B 2982..2986 CDD:409353
Ig strand C 2995..2999 CDD:409353
Ig strand E 3018..3022 CDD:409353
Ig strand F 3032..3037 CDD:409353
I-set 3069..3147 CDD:400151
Ig strand B 3077..3081 CDD:409353
Ig strand C 3090..3094 CDD:409353
Ig strand E 3113..3117 CDD:409353
Ig strand F 3127..3132 CDD:409353
Ig strand G 3140..3143 CDD:409353
Ig_3 3150..3228 CDD:464046
Ig 3244..3338 CDD:472250
Ig strand B 3264..3268 CDD:409353
Ig strand C 3277..3281 CDD:409353
Ig strand E 3302..3306 CDD:409353
Ig strand F 3316..3321 CDD:409353
Ig strand G 3329..3332 CDD:409353
I-set 3354..3430 CDD:400151
Ig strand B 3360..3364 CDD:409353
Ig strand C 3373..3377 CDD:409353
Ig strand E 3396..3400 CDD:409353
Ig strand F 3410..3415 CDD:409353
Ig strand G 3423..3426 CDD:409353
Ig 3441..3523 CDD:472250 23/104 (22%)
Ig strand B 3453..3457 CDD:409353 0/3 (0%)
Ig strand C 3466..3470 CDD:409353 1/3 (33%)
Ig strand E 3488..3493 CDD:409353 1/4 (25%)
Ig strand F 3503..3508 CDD:409353 1/6 (17%)
Ig strand G 3516..3519 CDD:409353 0/2 (0%)
Ig 3533..3606 CDD:472250 23/83 (28%)
Ig strand B 3546..3550 CDD:409353 2/3 (67%)
Ig strand C 3559..3563 CDD:409353 1/3 (33%)
Ig strand E 3581..3586 CDD:409353 3/11 (27%)
Ig strand F 3596..3601 CDD:409353 2/4 (50%)
I-set 3629..3709 CDD:400151 28/81 (35%)
Ig strand B 3639..3643 CDD:409353 1/3 (33%)
Ig strand C 3652..3656 CDD:409353 0/3 (0%)
Ig strand E 3674..3679 CDD:409353 0/4 (0%)
Ig strand F 3689..3694 CDD:409353 3/4 (75%)
Ig strand G 3702..3705 CDD:409353 0/2 (0%)
Ig_3 3712..3787 CDD:464046 18/76 (24%)
Ig 3823..3884 CDD:409353 14/64 (22%)
Ig strand C 3834..3838 CDD:409353 0/3 (0%)
Ig strand E 3859..3863 CDD:409353 1/3 (33%)
Ig strand F 3873..3878 CDD:409353 2/4 (50%)
Ig 3899..3984 CDD:472250 25/107 (23%)
Ig strand B 3914..3918 CDD:409353 0/5 (0%)
Ig strand C 3927..3931 CDD:409353 1/3 (33%)
Ig strand E 3950..3954 CDD:409353 1/3 (33%)
Ig strand F 3964..3969 CDD:409353 3/19 (16%)
Ig strand G 3977..3980 CDD:409353 0/2 (0%)
Ig_3 3987..4062 CDD:464046 15/85 (18%)
I-set 4089..4165 CDD:400151 17/84 (20%)
Ig strand B 4096..4100 CDD:409353 1/5 (20%)
Ig strand C 4109..4113 CDD:409353 0/3 (0%)
Ig strand E 4131..4135 CDD:409353 1/3 (33%)
Ig strand F 4145..4150 CDD:409353 1/4 (25%)
Ig strand G 4158..4161 CDD:409353 1/2 (50%)
Ig_3 4168..4243 CDD:464046 22/117 (19%)
I-set 4260..4345 CDD:400151 18/96 (19%)
Ig strand B 4277..4281 CDD:409353 0/3 (0%)
Ig strand C 4290..4294 CDD:409353 0/3 (0%)
Ig strand E 4311..4315 CDD:409353 0/3 (0%)
Ig strand F 4325..4330 CDD:409353 1/4 (25%)
Ig 4356..4435 CDD:472250 17/89 (19%)
Ig strand B 4367..4371 CDD:409353 0/3 (0%)
Ig strand C 4380..4384 CDD:409353 0/3 (0%)
Ig strand E 4402..4406 CDD:409353 1/3 (33%)
Ig strand F 4416..4421 CDD:409353 0/9 (0%)
Ig strand G 4429..4432 CDD:409353 0/2 (0%)
Ig 4441..4526 CDD:472250 8/32 (25%)
Ig strand B 4457..4461 CDD:409353 0/3 (0%)
Ig strand C 4470..4474 CDD:409353 1/3 (33%)
Ig strand E 4492..4496 CDD:409353
Ig strand F 4506..4511 CDD:409353
Ig strand G 4519..4522 CDD:409353
TSP1 4533..4584 CDD:214559
TSP1 4589..4641 CDD:214559
TSP1 4646..4698 CDD:214559
TSP1 4703..4755 CDD:214559
TSP1 4760..4812 CDD:214559
TSP1 4817..4869 CDD:214559
G2F 4868..5092 CDD:214774
EGF_CA 5107..5146 CDD:214542
EGF_CA 5147..5174 CDD:429571
EGF_CA 5192..5229 CDD:214542
EGF_CA 5230..5263 CDD:238011
EGF_CA 5272..5303 CDD:429571
EGF_CA 5315..5354 CDD:214542
EGF_CA 5432..5471 CDD:214542
EGF_CA 5472..5508 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.