DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and NECTIN3

DIOPT Version :10

Sequence 1:NP_523469.2 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_011510965.1 Gene:NECTIN3 / 25945 HGNCID:17664 Length:580 Species:Homo sapiens


Alignment Length:397 Identity:91/397 - (22%)
Similarity:154/397 - (38%) Gaps:67/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ALSSTTLADESIDTRENADLTLKCRFNDKYEAND--FSFFWTRWTANPAQFDNVAIGEVQLSSGY 97
            ||:...:.:..:......:::|||..    |.|:  ....|.:.....:|  .||:...|.....
Human    86 ALAGPIIVEPHVTAVWGKNVSLKCLI----EVNETITQISWEKIHGKSSQ--TVAVHHPQYGFSV 144

  Fly    98 RLDFQPERGIYDLQIKNVSYN-----------RDNGRFECRIKAKGTGADVHQEFHNLTVLTPPH 151
            :.::|..     :..||.|.|           .|:|::.|:......|.  .|....:|||..|.
Human   145 QGEYQGR-----VLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGN--AQSSTTVTVLVEPT 202

  Fly   152 PPVISPGNIAVATEDKPMELTCSSIGGSPDPTITWYREGSNTPLPATVLKGGTKDQPTNATLSII 216
            ..:|...:..:...::.:...|.:..|.|...|.|  ||....:.:|     |...| |.|.:||
Human   203 VSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDW--EGDLGEMEST-----TTSFP-NETATII 259

  Fly   217 ------PRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPRVEV-GPENPLRVERDRTAKLE 274
                  |.|...|.:..|||::.|:.  |.:..:..|::.|.|.|.| |.:....|.| :...|:
Human   260 SQYKLFPTRFARGRRITCVVKHPALE--KDIRYSFILDIQYAPEVSVTGYDGNWFVGR-KGVNLK 321

  Fly   275 CNVDAKPKVPNVRWNR------NGRFISSSLVHTIHRVSVQDAGKYTCIADNGLGKTGEQELILD 333
            ||.||.|......|:|      :|...|.:.:|.:|.::...:|.|.|...|.||:..:|::|. 
Human   322 CNADANPPPFKSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQKVIY- 385

  Fly   334 ILYPPMVVIESKTREAEEGDTVTIRCNVTANPAPVTIEWLKENSPDFRYNGDVLTLTSVRADHAG 398
            |..||              .|.|::..:..:|:...||.|........:  .:.||.:::.|...
Human   386 ISDPP--------------TTTTLQPTIQWHPSTADIEDLATEPKKLPF--PLSTLATIKDDTIA 434

  Fly   399 NYICRAV 405
            ..|...|
Human   435 TIIASVV 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_523469.2 V-set 50..147 CDD:462230 21/109 (19%)
Ig 153..249 CDD:472250 24/101 (24%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 183..187 CDD:409353 1/3 (33%)
Ig strand E 211..215 CDD:409353 1/3 (33%)
Ig strand F 225..230 CDD:409353 1/4 (25%)
Ig strand G 242..245 CDD:409353 0/2 (0%)
Ig_3 253..320 CDD:464046 21/73 (29%)
Ig_3 337..406 CDD:464046 13/69 (19%)
Ig_2 437..>504 CDD:464026
Ig 525..635 CDD:472250
Ig strand B 545..549 CDD:409568
Ig strand C 558..562 CDD:409568
Ig strand E 587..591 CDD:409568
Ig strand F 615..620 CDD:409568
Ig strand G 628..631 CDD:409568
Ig_3 639..724 CDD:464046
FN3 741..848 CDD:238020
NECTIN3XP_011510965.1 IgV_1_Nectin-3_like 89..198 CDD:409470 21/121 (17%)
FR1 89..112 CDD:409470 3/26 (12%)
Ig strand A 89..93 CDD:409470 0/3 (0%)
Ig strand A' 95..99 CDD:409470 0/3 (0%)
Ig strand B 104..112 CDD:409470 3/11 (27%)
CDR1 113..117 CDD:409470 1/3 (33%)
FR2 118..124 CDD:409470 1/5 (20%)
Ig strand C 119..124 CDD:409470 1/4 (25%)
CDR2 125..144 CDD:409470 4/20 (20%)
Ig strand C' 134..139 CDD:409470 1/4 (25%)
Ig strand C' 141..145 CDD:409470 0/3 (0%)
FR3 145..183 CDD:409470 8/42 (19%)
Ig strand D 152..156 CDD:409470 0/3 (0%)
Ig strand E 161..168 CDD:409470 0/6 (0%)
Ig strand F 175..183 CDD:409470 2/7 (29%)
CDR3 184..187 CDD:409470 0/2 (0%)
Ig strand G 187..197 CDD:409470 2/11 (18%)
FR4 188..198 CDD:409470 2/11 (18%)
IgC1_2_Nectin-3-4_like 201..296 CDD:409501 25/104 (24%)
Ig strand A 201..207 CDD:409501 1/5 (20%)
Ig strand B 220..227 CDD:409501 1/6 (17%)
Ig strand C 232..238 CDD:409501 2/7 (29%)
Ig strand C' 240..242 CDD:409501 0/1 (0%)
Ig strand D 244..251 CDD:409501 2/11 (18%)
Ig strand E 256..264 CDD:409501 2/7 (29%)
Ig strand F 274..281 CDD:409501 3/6 (50%)
Ig strand G 287..293 CDD:409501 0/5 (0%)
Ig 300..386 CDD:472250 26/87 (30%)
Ig strand B 318..322 CDD:409353 1/3 (33%)
Ig strand C 332..336 CDD:409353 0/3 (0%)
Ig strand E 351..356 CDD:409353 1/4 (25%)
Ig strand F 366..371 CDD:409353 2/4 (50%)
Ig strand G 381..384 CDD:409353 1/2 (50%)
TM_EGFR-like 435..463 CDD:213052 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.