| Sequence 1: | NP_523469.2 | Gene: | ed / 33619 | FlyBaseID: | FBgn0000547 | Length: | 1332 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_997127.1 | Gene: | Cd200r4 / 239849 | MGIID: | 3036289 | Length: | 270 | Species: | Mus musculus |
| Alignment Length: | 151 | Identity: | 36/151 - (23%) |
|---|---|---|---|
| Similarity: | 56/151 - (37%) | Gaps: | 38/151 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 487 PQYSIPKAHLGNEGKYHCHAVNELGIGMMATIVLEIHQPPQ---FLAKLQQHMTRRVADTDYTVT 548
Fly 549 CSA-KGKPAPSVKWLKDAVEILPEENLYEVQTNPDQGLNGMVTVQSQLKFRGKARPNGNALVPGD 612
Fly 613 RGLYTCLYQNEVNSANSSMQL 633 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ed | NP_523469.2 | V-set | 50..147 | CDD:462230 | |
| Ig | 153..249 | CDD:472250 | |||
| Ig strand B | 169..173 | CDD:409353 | |||
| Ig strand C | 183..187 | CDD:409353 | |||
| Ig strand E | 211..215 | CDD:409353 | |||
| Ig strand F | 225..230 | CDD:409353 | |||
| Ig strand G | 242..245 | CDD:409353 | |||
| Ig_3 | 253..320 | CDD:464046 | |||
| Ig_3 | 337..406 | CDD:464046 | |||
| Ig_2 | 437..>504 | CDD:464026 | 6/16 (38%) | ||
| Ig | 525..635 | CDD:472250 | 26/113 (23%) | ||
| Ig strand B | 545..549 | CDD:409568 | 1/3 (33%) | ||
| Ig strand C | 558..562 | CDD:409568 | 0/3 (0%) | ||
| Ig strand E | 587..591 | CDD:409568 | 2/3 (67%) | ||
| Ig strand F | 615..620 | CDD:409568 | 1/4 (25%) | ||
| Ig strand G | 628..631 | CDD:409568 | 0/2 (0%) | ||
| Ig_3 | 639..724 | CDD:464046 | |||
| FN3 | 741..848 | CDD:238020 | |||
| Cd200r4 | NP_997127.1 | IgV_CD200R-like | 41..147 | CDD:409577 | 10/35 (29%) |
| FR1 | 41..59 | CDD:409577 | |||
| Ig strand A | 41..47 | CDD:409577 | |||
| Ig strand A' | 49..51 | CDD:409577 | |||
| Ig strand B | 53..60 | CDD:409577 | |||
| CDR1 | 60..68 | CDD:409577 | |||
| Ig strand C | 68..76 | CDD:409577 | |||
| FR2 | 69..77 | CDD:409577 | |||
| CDR2 | 78..96 | CDD:409577 | |||
| Ig strand C' | 82..87 | CDD:409577 | |||
| Ig strand C' | 91..96 | CDD:409577 | |||
| FR3 | 97..133 | CDD:409577 | 7/20 (35%) | ||
| Ig strand D | 101..106 | CDD:409577 | |||
| Ig strand E | 111..118 | CDD:409577 | 2/5 (40%) | ||
| Ig strand F | 125..133 | CDD:409577 | 3/7 (43%) | ||
| CDR3 | 134..136 | CDD:409577 | 0/1 (0%) | ||
| FR4 | 137..147 | CDD:409577 | 1/9 (11%) | ||
| Ig strand G | 137..147 | CDD:409577 | 1/9 (11%) | ||
| Ig | 162..230 | CDD:472250 | 21/88 (24%) | ||
| Ig strand C | 174..177 | CDD:409500 | 0/2 (0%) | ||
| Ig strand F | 209..215 | CDD:409500 | 2/12 (17%) | ||
| Ig strand G | 223..226 | CDD:409500 | 0/2 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||