DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and Cd200r4

DIOPT Version :10

Sequence 1:NP_523469.2 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_997127.1 Gene:Cd200r4 / 239849 MGIID:3036289 Length:270 Species:Mus musculus


Alignment Length:151 Identity:36/151 - (23%)
Similarity:56/151 - (37%) Gaps:38/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 PQYSIPKAHLGNEGKYHCHAVNELGIGMMATIVLEIHQPPQ---FLAKLQQHMTRRVADTDYTVT 548
            |:..|....|.:||.|.|..|...| .:.....|::..||:   |..|            :.|..
Mouse   112 PELQISAVALQHEGTYTCEIVTPEG-NLEKVYDLQVL
VPPEVTYFPGK------------NRTAV 163

  Fly   549 CSA-KGKPAPSVKWLKDAVEILPEENLYEVQTNPDQGLNGMVTVQSQLKFRGKARPNGNALVPGD 612
            |.| .||||..:.|..|.          :..|..:...||.|||:|...:    ..|..::|   
Mouse   164 CEAMAGKPAAQISWTPDG----------DCVTKSESHSNGTVTVRSTCHW----EQNNVSVV--- 211

  Fly   613 RGLYTCLYQNEVNSANSSMQL 633
                :||..:...:.:.|::|
Mouse   212 ----SCLVSHSTGNQSLSIEL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_523469.2 V-set 50..147 CDD:462230
Ig 153..249 CDD:472250
Ig strand B 169..173 CDD:409353
Ig strand C 183..187 CDD:409353
Ig strand E 211..215 CDD:409353
Ig strand F 225..230 CDD:409353
Ig strand G 242..245 CDD:409353
Ig_3 253..320 CDD:464046
Ig_3 337..406 CDD:464046
Ig_2 437..>504 CDD:464026 6/16 (38%)
Ig 525..635 CDD:472250 26/113 (23%)
Ig strand B 545..549 CDD:409568 1/3 (33%)
Ig strand C 558..562 CDD:409568 0/3 (0%)
Ig strand E 587..591 CDD:409568 2/3 (67%)
Ig strand F 615..620 CDD:409568 1/4 (25%)
Ig strand G 628..631 CDD:409568 0/2 (0%)
Ig_3 639..724 CDD:464046
FN3 741..848 CDD:238020
Cd200r4NP_997127.1 IgV_CD200R-like 41..147 CDD:409577 10/35 (29%)
FR1 41..59 CDD:409577
Ig strand A 41..47 CDD:409577
Ig strand A' 49..51 CDD:409577
Ig strand B 53..60 CDD:409577
CDR1 60..68 CDD:409577
Ig strand C 68..76 CDD:409577
FR2 69..77 CDD:409577
CDR2 78..96 CDD:409577
Ig strand C' 82..87 CDD:409577
Ig strand C' 91..96 CDD:409577
FR3 97..133 CDD:409577 7/20 (35%)
Ig strand D 101..106 CDD:409577
Ig strand E 111..118 CDD:409577 2/5 (40%)
Ig strand F 125..133 CDD:409577 3/7 (43%)
CDR3 134..136 CDD:409577 0/1 (0%)
FR4 137..147 CDD:409577 1/9 (11%)
Ig strand G 137..147 CDD:409577 1/9 (11%)
Ig 162..230 CDD:472250 21/88 (24%)
Ig strand C 174..177 CDD:409500 0/2 (0%)
Ig strand F 209..215 CDD:409500 2/12 (17%)
Ig strand G 223..226 CDD:409500 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.