DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and malt-1

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_495424.2 Gene:malt-1 / 174135 WormBaseID:WBGene00017702 Length:639 Species:Caenorhabditis elegans


Alignment Length:726 Identity:135/726 - (18%)
Similarity:214/726 - (29%) Gaps:270/726 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LPATVLKGGTKD-QPTNATLSIIPRREDD------------GAKYKC---VVR---NRAMNEGKR 240
            ||..:.|..::: |..|..:.|:...||.            ..:.||   |:|   ||....|..
 Worm     8 LPVRIFKILSEELQKDNIWIKIVEFDEDPIYYMKSTEIESFLKREKCCEQVLRKWGNRGQTVGSL 72

  Fly   241 LEATATLNVNYYPRVE----------------VGPENPLRVERDR-TAKLECNVDAKPKVPNVRW 288
            |.....|:..|....:                ..||..:..|.|. ..||||.....| .|.::|
 Worm    73 LARLQFLSRTYEDEFDSIQFHLRRKFKPLRWIPDPEQQVTKEIDEGNIKLECKAQGFP-CPEIKW 136

  Fly   289 NRNGRFISSSLVH-----TIHRVSVQDAGKYTCIADNGLGKTGEQELILDILYPPMVVIESKTRE 348
            ...|   |...||     ||.|....:..:|.|:|.|                           |
 Worm   137 FTKG---SKEPVHIGRVYTILRCKCSNEHQYKCVAKN---------------------------E 171

  Fly   349 AEEGDTVTIRCNVTANPAPVTIEWLKENSPDFR--YNGDVLTLTS-VRADHAGNYICRAVNIMQ- 409
            ..||...:              |..::....|.  ...:.:.:|| :|.|.    :|.:....: 
 Worm   172 IREGSPYS--------------EIYRKAGKQFSSVIESEYVDVTSCIRDDE----LCESCKKYEM 218

  Fly   410 ---SQGMERSERVGNSTVA-------LLVRHRPGQAYITPNKPVVHVGNGVTLTCSANP------ 458
               ||.:...:....:.|:       :.:|.....|.|..|...||:....|..|.|..      
 Worm   219 GRLSQILAEDQEKPENKVSPVRPNLDITLRAADKVALIMSNCSYVHLPELRTPHCDAQTLADALQ 283

  Fly   459 ---------PGWPVPQYRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEGKYHCHAVNELGIGM 514
                     ....:.:.|:|      ....||::..|..........|.|....|:.   ||:..
 Worm   284 KMNYKTVTLADLTLDEMRYF------IRVYQKLIGNGVYAVFYFVGHGFEVNGQCYL---LGVDA 339

  Fly   515 MATIVLEIHQPPQFLAKLQQHMTRRVADTDYTVTCSAKGKPAPSVKWLKDAVEIL----PEENLY 575
            .|    :.|||        ||                    :.|:.||   :.|.    |:.||.
 Worm   340 PA----DAHQP--------QH--------------------SMSMDWL---LSIFRHKTPDLNLL 369

  Fly   576 EVQT----NPDQGLNGMVTVQSQLKFRGKARPN---GNALVPGDRGLYTCLYQNEVNSA-----N 628
            .:..    .|...::..|....|.|...:|..|   |.: ..|..|.|.  .:.|||..     .
 Worm   370 LLDVCRKFVPYDAISAFVEYSEQFKKFHRAHRNMVYGYS-TSGGVGAYE--VKGEVNGVFMKYLK 431

  Fly   629 SSMQLRIEHEPIVLHQYNKVAFDIRETAEVVCKVQAYPKPEFQ---------------------- 671
            :.:||.|.    |:...|||..||.:. :.||.:|.   ||.:                      
 Worm   432 NHVQLEIS----VIDMLNKVLLDIGDD-QKVCDLQV---PEIRSTLTHPRSLADPLIFDGHTASF 488

  Fly   672 ------WQFGNN-PSPLTMSSDGHYEISTT--------TDNNDIYTSV----------------- 704
                  |:..:. |:|.|:..:....::|.        |:...::.|:                 
 Worm   489 DNHTIHWRLMHELPTPATIRFETQQLVATIWFQFCGNFTNKVYVFASISDFRPCQEDTDMGENEE 553

  Fly   705 LKINSLTH------------SDYGEYT--------CRVANTLDTIR------APIRLQQKGPPEK 743
            |..|:|.|            ||..||.        ..:.:.|..|:      ..:.|:....|||
 Worm   554 LSENALNHRAFVEFPEELHCSDVREYNDDEEGVSMLWILSGLQKIKKEAGLTCEVHLRHVDDPEK 618

  Fly   744 PTNLRATEVGH 754
            ...::..::||
 Worm   619 TIEMKNVDIGH 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845
I-set 146..249 CDD:254352 17/72 (24%)
Ig 168..249 CDD:299845 17/72 (24%)
IGc2 268..323 CDD:197706 19/60 (32%)
Ig_3 341..406 CDD:290638 10/67 (15%)
Ig_2 437..514 CDD:290606 17/91 (19%)
I-set 526..633 CDD:254352 22/122 (18%)
Ig 546..632 CDD:143165 20/101 (20%)
IG_like 654..736 CDD:214653 22/161 (14%)
Ig 656..734 CDD:143165 22/157 (14%)
FN3 741..848 CDD:238020 5/14 (36%)
malt-1NP_495424.2 Ig 122..182 CDD:299845 21/104 (20%)
Peptidase_C14 252..481 CDD:279049 58/283 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7699
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.