DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC110439985

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_021333823.1 Gene:LOC110439985 / 110439985 -ID:- Length:251 Species:Danio rerio


Alignment Length:255 Identity:61/255 - (23%)
Similarity:91/255 - (35%) Gaps:105/255 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 GRFISSSLVHTIHRVSVQDAGKYTCIADNGLGKTGEQELILDILYPPMVVIESKTREAEEGDTVT 356
            ||:|....|    |:||.|                     |.::.|..|.         |||:|.
Zfish    66 GRWIGIPGV----RLSVTD---------------------LQLVSPERVT---------EGDSVR 96

  Fly   357 IRCN----VTANPAPVTIEWLKENSPDFRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSE 417
            :.||    :|..|   |..|.: ||......||.|.:.||....||:|.|         |::   
Zfish    97 LTCNSSCKLTDTP---TFIWYR-NSHTLTNIGDELNIRSVSRTEAGHYSC---------GVQ--- 145

  Fly   418 RVGNSTVALLVRHRPGQAYIT----------PNKPVVHV--------GNGVTLTCS--ANPPGWP 462
                           ||.||:          |:.||:.:        |:.|||:||  :|||.  
Zfish   146 ---------------GQTYISPAVYLNVTYAPDTPVISISGSAVIMSGDSVTLSCSSDSNPPA-- 193

  Fly   463 VPQYRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEGKYHCHAVNELGIGMMATIVLEI 522
              :..||:.        .|.|..|..::|.    .:.|:|.|...|:.|:.....::|.:
Zfish   194 --EINWFKG--------NKALDSGRIFNIS----DDSGEYKCRVRNDHGVKYSVAVILNV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845
I-set 146..249 CDD:254352
Ig 168..249 CDD:299845
IGc2 268..323 CDD:197706 8/30 (27%)
Ig_3 341..406 CDD:290638 21/68 (31%)
Ig_2 437..514 CDD:290606 24/96 (25%)
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
LOC110439985XP_021333823.1 Ig_3 85..142 CDD:316449 22/69 (32%)
Ig_2 165..239 CDD:316418 23/89 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.