DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ed and LOC110439975

DIOPT Version :9

Sequence 1:	NP_001260013.1	Gene:	ed / 33619	FlyBaseID:	FBgn0000547	Length:	1332	Species:	Drosophila melanogaster
Sequence 2:	XP_021333801.1	Gene:	LOC110439975 / 110439975	-ID:	-	Length:	170	Species:	Danio rerio

Alignment Length:	136	Identity:	40/136 - (29%)
Similarity:	72/136 - (52%)	Gaps:	6/136 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   273 LECNVDAKPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGKYTCIADNGLGKTGEQELILDILYP 337
            |.|:.|:.| :..:.|.:..:::.|..:..|.::|..|:|:|.|.|.|..|:.....:.||:.||
Zfish     8 LNCSSDSNP-IAEISWFKATKYVGSGRIFNISKISSADSGEYKCRARNEHGEKYSDPVTLDVQYP 71

  Fly   338 PMVVIESKTREA--EEGDTVTIRCNVTANPAPVTIEWLKENSPDFRYNGDVLTLTSVRADHAGNY 400
            |..:..|.:..:  ..||:||:.|:..:|| |..|.|.|..:  |..:|.:..::::.:|.:|.|
Zfish    72 PRNISVSLSGPSVIMSGDSVTLSCSSDSNP-PAEISWFKGET--FIRSGRIFNISNISSDDSGEY 133

  Fly   401 ICRAVN 406
            .||..|
Zfish   134 KCRVRN 139

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ed	NP_001260013.1	Ig	50..147	CDD:299845
		I-set	146..249	CDD:254352
		Ig	168..249	CDD:299845
		IGc2	268..323	CDD:197706	14/49 (29%)
		Ig_3	341..406	CDD:290638	19/66 (29%)
		Ig_2	437..514	CDD:290606
		I-set	526..633	CDD:254352
		Ig	546..632	CDD:143165
		IG_like	654..736	CDD:214653
		Ig	656..734	CDD:143165
		FN3	741..848	CDD:238020
LOC110439975	XP_021333801.1	Ig_2	3..68	CDD:316418	16/60 (27%)
LOC110439975	XP_021333801.1	Ig_2	82..153	CDD:316418	19/61 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D35531at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010