DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC108648322

DIOPT Version :10

Sequence 1:NP_523469.2 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_017952078.1 Gene:LOC108648322 / 108648322 XenbaseID:XB-GENE-29091151 Length:623 Species:Xenopus tropicalis


Alignment Length:554 Identity:117/554 - (21%)
Similarity:180/554 - (32%) Gaps:156/554 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 AMNEGKRLEATATLNVNYYPRVEVGPENPLRVERDRTAKLECNVDAKPK-VPNVRWNRNG-RFIS 296
            |.|.|....||.:.:.|:           .......:..|.|||.:..: .|...|.::| |..:
 Frog    14 AENAGAAGRATVSFSPNW-----------ASAFTSESVTLTCNVSSSAQGEPPYFWYKDGVRMET 67

  Fly   297 SSLVHTIHRVSVQDAGKYTC--------------IADNGLGKTGEQELILDILYPPMVVIESKTR 347
            ....:||......|:|.|.|              |:|:          .|.:..||.|.      
 Frog    68 KQQKYTIFNAKKSDSGVYQCKSHSSDRSDSVTLTISDD----------YLSLKVPPFVF------ 116

  Fly   348 EAEEGDTVTIRCNVTANPAPVTIEWLKEN-----SPDFRYN-GDVLTLTSVRADHAGNYIC-RAV 405
               |||.:.:.|.........|.:..|.|     ||...:| |.|...||      |:||| |||
 Frog   117 ---EGDNLQVSCAGYPGYKADTAKLNKGNQLIGSSPSGNFNFGRVTMATS------GSYICYRAV 172

  Fly   406 N---IMQSQGMERSERVGNSTVALLVRHRPGQAYITPNKPVVHVGNGVTLTCSAN-PPGWPVPQ- 465
            .   |..:|         .|:|.:.|:.......|..:...|..|:.:|:||... .|.....: 
 Frog   173 KHHLIYYNQ---------KSSVYISVKELFSSPQIKVSTDQVTEGDRMTITCDTELSPHRETTEL 228

  Fly   466 ----YRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEGKYHCHAVNELGI----GMMATIVLEI 522
                ||...::.| ||.:.       ||.:..|.|.:.|.|.|....:.||    ....:|.:..
 Frog   229 QFAFYRNGHNVQG-FSLSN-------QYGVSSAQLEDSGYYTCEIRAQSGIVNKKSDRKSIQIRT 285

  Fly   523 HQPPQFLAKLQQHMTRRVADTDYTVTCSA-KGKPAPSVKWLKDAVEI-------LPEENLYEVQT 579
            .:......:|:....:.:|.....:.||. ||.......|.|....|       .||:.......
 Frog   286 KKLAGVRVRLEPAGGQVIAGEKLEILCSVEKGMGLLRYSWCKQPTLICNTKEAAAPEQRFVAESV 350

  Fly   580 NPDQGLNGMVTVQSQLKFRGKARPNGNALVPGDRGLYTCLYQ-----NEVNSANSSMQLRIEHEP 639
            :.|.|                             |.|.|:..     ..:.|||.|:.::   ||
 Frog   351 SEDYG-----------------------------GEYQCIITRTATGESIRSANISISVQ---EP 383

  Fly   640 I----VLHQYNKVAFDIRETAEVVCKVQAYPKPEFQWQFGNNPSPLTMSSDGH----YEISTTTD 696
            :    :..:.:::|..:.:...:.|.|.....|.|.|...|       .:.||    |::..:  
 Frog   384 VADARITPEEDELAVKVEDNLCLTCSVAKGTNPLFLWIHNN-------KTIGHESVLYQVRES-- 439

  Fly   697 NNDIYTSVLKINSLTHSDYGEYTCRVANTLDTIR 730
                 ..||.|.|......|.|.|.|.|.|.:.|
 Frog   440 -----GKVLCIESAQLQHAGTYWCEVRNQLSSNR 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_523469.2 V-set 50..147 CDD:462230
Ig 153..249 CDD:472250 5/14 (36%)
Ig strand B 169..173 CDD:409353
Ig strand C 183..187 CDD:409353
Ig strand E 211..215 CDD:409353
Ig strand F 225..230 CDD:409353
Ig strand G 242..245 CDD:409353 1/2 (50%)
Ig_3 253..320 CDD:464046 15/82 (18%)
Ig_3 337..406 CDD:464046 23/75 (31%)
Ig_2 437..>504 CDD:464026 18/72 (25%)
Ig 525..635 CDD:472250 20/122 (16%)
Ig strand B 545..549 CDD:409568 0/3 (0%)
Ig strand C 558..562 CDD:409568 0/3 (0%)
Ig strand E 587..591 CDD:409568 0/3 (0%)
Ig strand F 615..620 CDD:409568 2/4 (50%)
Ig strand G 628..631 CDD:409568 1/2 (50%)
Ig_3 639..724 CDD:464046 19/92 (21%)
FN3 741..848 CDD:238020
LOC108648322XP_017952078.1 Ig 23..102 CDD:472250 17/89 (19%)
Ig strand B 40..44 CDD:409410 1/3 (33%)
Ig strand C 55..59 CDD:409410 0/3 (0%)
Ig strand E 70..74 CDD:409410 0/3 (0%)
Ig strand F 84..89 CDD:409410 2/4 (50%)
Ig strand G 95..98 CDD:409410 0/2 (0%)
Ig 200..283 CDD:472250 21/90 (23%)
Ig strand B 211..215 CDD:409411 1/3 (33%)
Ig strand C 229..233 CDD:409411 0/3 (0%)
Ig strand E 246..250 CDD:409411 2/10 (20%)
Ig strand F 260..267 CDD:409411 2/6 (33%)
Ig strand G 276..279 CDD:409411 0/2 (0%)
Ig_3 388..462 CDD:464046 18/87 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.