DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and kirrel3

DIOPT Version :10

Sequence 1:NP_523469.2 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_031761736.1 Gene:kirrel3 / 105947809 XenbaseID:XB-GENE-922296 Length:773 Species:Xenopus tropicalis


Alignment Length:793 Identity:184/793 - (23%)
Similarity:292/793 - (36%) Gaps:171/793 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DNVAIGEVQLSSGYRLDFQPE--------RGIYDLQIKNVSYNRDNGRFECRIKAKGTGADVHQE 140
            |.:|||..:..|||     |.        .|.:.|.|:.... :|:..:||    :...|.:...
 Frog    79 DGLAIGVGRDLSGY-----PRYSVGGDHLSGEHHLMIQRAEL-QDDAMYEC----QAIQAAIRSR 133

  Fly   141 FHNLTVLTPPHPPVISPGNIAVATEDKPMELTCSSIGGSPDPTITWYREGSNTPLPATVLKGGT- 204
            ...||||.||..|||:.|.:.......|:.|||.:....|..||||.:.|.       ||.|.| 
 Frog   134 PARLTVLVPPDDPVITGGPVISIRAGDPLNLTCHADNAKPAATITWMKNGE-------VLNGATY 191

  Fly   205 --------KDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPRVEVGPEN 261
                    |.:...:||.:.....::|....|...|:|:..||  |||.|:|:.:.|.|.:..| 
 Frog   192 YKTLLRDGKRESIISTLFVSSSDIENGQTITCRATNKAVPGGK--EATVTINIQHPPLVNLTVE- 253

  Fly   262 PLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGKYT----CIADNGL 322
            |..|..|...|..|...|.|.|...||.:.|:.:......|..  :|.|...:|    |...|.|
 Frog   254 PQPVLEDNVVKFHCAAKANPAVTQYRWAKGGQILKEVTDETYE--TVVDFSFFTEPVSCEVTNAL 316

  Fly   323 GKTGEQELILDILYPPMVVIESKTREAEEGDTVTIRCNVTANPAPVTIEWLKENSPDFRYNGDVL 387
            |.|.....: |:.:.|.:..|.::...:.|...|..|....||: :||.|:|..|.....|.:.|
 Frog   317 GSTNVSRTV-DVYFGPRMSSEPESITVDLGSDATFHCAWIGNPS-LTIVWMKRGSGVVLSNENTL 379

  Fly   388 TLTSVRADHAGNYICRAVNIMQSQGMERSERV--GNSTVALLVRHRPGQAYITPNKPVVHVGNGV 450
            ||.:||.:.||.|:||||          ..||  |...::|.| :.|.....|..:..:| |...
 Frog   380 TLKNVRQEDAGKYVCRAV----------VPRVGAGERDISLTV-NGPPIISSTQTQHALH-GEKG 432

  Fly   451 TLTC---SANPPGWPVPQYRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEGKYHCHAVNELGI 512
            .:.|   |..||    .:..|        |..:.:|..           |..|:|....|: ...
 Frog   433 QIKCFIRSTPPP----DRIAW--------SWKENVLES-----------GTSGRYTVETVS-TDE 473

  Fly   513 GMMATIVLEIHQPPQFLAKLQQHMTRRVADTDYTVTC-SAKGKPAPSVKWLKDAVEILPEENLYE 576
            |:::|:.:             .::.|....|.|..|. ::.|.....:: ||:....:......|
 Frog   474 GVISTLTI-------------SNIVRADFQTIYNCTAWNSFGSDTEIIR-LKEQGPNMQSGTSME 524

  Fly   577 VQTNPDQGLNGMVTVQSQLKFRGKARPNGNALVPGDRGLYTCLYQNEVN-----SANSSMQLRIE 636
            .::.|...:.| |.|.:.:.|          ||.....:..|..:|:.|     ||.:.:::.|.
 Frog   525 PESVPVTVIIG-VAVGAGVAF----------LVLMATIVAFCCARNQRNLKGVVSAKNDIRVEIV 578

  Fly   637 H-EPIVLHQYNKVAFDIRETAE-VVCKVQAYPKPEFQW---------------QFGNNPSPLTMS 684
            | ||..          .|||.: ...|.....:.|||.               :|.|...|    
 Frog   579 HKEPST----------GRETEDHSTIKQLMIDRGEFQQDSVLKQLEVLKEEEKEFQNLKDP---- 629

  Fly   685 SDGHYEISTTTDNNDIYTSVLKINSLTHSDYGEYTCRVANTLDTIRAPIRLQQKGPPEKPTNLRA 749
            ::|:|.::                  |..|:...|..::|....:| |...|:.......||:.:
 Frog   630 TNGYYSVN------------------TFKDHSTPTISLSNCQQDLR-PANKQRVPTGMSFTNIYS 675

  Fly   750 TEVGHNYVSLSWDPGFDGGLSKTKFFV---SYRRVAMPREEQLIPDCATLANSNSAWVEVDCQRD 811
            |..|.|.: ..:...|..|:..:...:   .::|.:|......:......:.|:|...:...|.|
 Frog   676 TLSGQNRL-YDYSQRFVLGMGSSSIELCEREFQRGSMSDSSSFLDTQCDSSVSSSGKQDGYVQFD 739

  Fly   812 IPCKVTALEQHQS 824
            ...|.:|...|.|
 Frog   740 KSSKASASSSHYS 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_523469.2 V-set 50..147 CDD:462230 17/70 (24%)
Ig 153..249 CDD:472250 31/104 (30%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 183..187 CDD:409353 3/3 (100%)
Ig strand E 211..215 CDD:409353 2/3 (67%)
Ig strand F 225..230 CDD:409353 1/4 (25%)
Ig strand G 242..245 CDD:409353 2/2 (100%)
Ig_3 253..320 CDD:464046 19/70 (27%)
Ig_3 337..406 CDD:464046 24/68 (35%)
Ig_2 437..>504 CDD:464026 13/69 (19%)
Ig 525..635 CDD:472250 20/115 (17%)
Ig strand B 545..549 CDD:409568 1/3 (33%)
Ig strand C 558..562 CDD:409568 0/3 (0%)
Ig strand E 587..591 CDD:409568 2/3 (67%)
Ig strand F 615..620 CDD:409568 1/4 (25%)
Ig strand G 628..631 CDD:409568 0/2 (0%)
Ig_3 639..724 CDD:464046 16/100 (16%)
FN3 741..848 CDD:238020 17/87 (20%)
kirrel3XP_031761736.1 IG_like 50..139 CDD:214653 16/69 (23%)
Ig strand B 61..65 CDD:409389
Ig strand C 73..77 CDD:409389
Ig strand E 100..110 CDD:409389 2/9 (22%)
Ig strand F 120..125 CDD:409389 2/8 (25%)
Ig strand G 132..135 CDD:409389 0/2 (0%)
IgI_2_KIRREL3-like 145..242 CDD:409416 31/105 (30%)
Ig strand A 146..149 CDD:409416 2/2 (100%)
Ig strand A' 152..156 CDD:409416 0/3 (0%)
Ig strand B 163..170 CDD:409416 3/6 (50%)
Ig strand C 175..180 CDD:409416 3/4 (75%)
Ig strand C' 183..185 CDD:409416 1/8 (13%)
Ig strand D 188..195 CDD:409416 2/6 (33%)
Ig strand E 202..210 CDD:409416 2/7 (29%)
Ig strand F 219..227 CDD:409416 1/7 (14%)
Ig strand G 233..239 CDD:409416 5/7 (71%)
Ig 331..412 CDD:472250 29/91 (32%)
Ig strand B 348..352 CDD:409549 1/3 (33%)
Ig strand C 361..365 CDD:409549 2/3 (67%)
Ig strand E 377..381 CDD:409549 1/3 (33%)
IgI_5_KIRREL3 414..511 CDD:409479 22/135 (16%)
Ig strand A 415..419 CDD:409479 1/3 (33%)
Ig strand A' 421..424 CDD:409479 1/2 (50%)
Ig strand B 432..439 CDD:409479 1/6 (17%)
Ig strand C 446..451 CDD:409479 1/12 (8%)
Ig strand C' 453..456 CDD:409479 0/2 (0%)
Ig strand D 464..471 CDD:409479 2/7 (29%)
Ig strand E 474..481 CDD:409479 2/6 (33%)
Ig strand F 492..499 CDD:409479 2/6 (33%)
Ig strand G 502..509 CDD:409479 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.