DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC103908692

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_021333409.1 Gene:LOC103908692 / 103908692 -ID:- Length:185 Species:Danio rerio


Alignment Length:167 Identity:47/167 - (28%)
Similarity:76/167 - (45%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 ENPLRVERDRTAKLECNVDAK-PKVPNVRWNRNGRFISSSLVHT---IHRVSVQDAGKYTCIADN 320
            |:|.||....:.:|.|....| ...|...|.||.:.::...:..   :..|..:|.|:|.|..  
Zfish    11 ESPERVTEGDSVRLTCRSSCKLTDTPTFIWYRNSQRLTEGTIGNKLILKSVGREDLGRYRCAV-- 73

  Fly   321 GLGKT-GEQELILDILYPPMVVIESKTREA--EEGDTVTIRCNVTANPAPVTIEWLKENSPDFRY 382
             .|.| ...|:.|::.|||..|..|.:..|  ..||:||:.|:..:|| |..|.|.|...  ...
Zfish    74 -YGHTLTSPEVYLNVTYPPKSVSVSISGSAVIMSGDSVTLSCSSDSNP-PGIISWFKGKM--LVG 134

  Fly   383 NGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERV 419
            :|.:.:::.:.:|.:|.|.|:|.|   :.|...|:.|
Zfish   135 SGRIFSISKISSDDSGEYKCKARN---AHGARYSDPV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845
I-set 146..249 CDD:254352
Ig 168..249 CDD:299845
IGc2 268..323 CDD:197706 12/58 (21%)
Ig_3 341..406 CDD:290638 20/66 (30%)
Ig_2 437..514 CDD:290606
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
LOC103908692XP_021333409.1 Ig_3 12..71 CDD:316449 14/58 (24%)
Ig_2 101..172 CDD:316418 22/74 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.