DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC101884775

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_009298710.1 Gene:LOC101884775 / 101884775 -ID:- Length:509 Species:Danio rerio


Alignment Length:505 Identity:105/505 - (20%)
Similarity:186/505 - (36%) Gaps:125/505 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CNFFLIALVALSSTTLADESIDTRENADLTLKCRF--NDKYE---ANDFSFFWTRWTANPAQ--- 82
            |..|.|:|         .|.|.....:.:.:||||  |:.|:   ....:..|.:.|.:.:.   
Zfish    19 CRDFNISL---------PEKIQALSGSCVVIKCRFEINETYDKDLTERAAGVWYKDTHDKSSSPV 74

  Fly    83 FDNVAIGEVQLSSGY---RLDFQPERGI-YDLQIKNVSYNRDNGRFECRIKAKGTGADVHQEFHN 143
            |::.|..:.....|.   :|:::....: ||:.      :..:|::..||:.:| |........|
Zfish    75 FNSSASTQNSFIKGNITGQLNYKDCTTVFYDVT------SNHSGQYFFRIEGEG-GLKWTFTKSN 132

  Fly   144 LTVL---TPPHPPVISPGN------IAVATEDKPMELTCSS--IGGSPDPTITWYREGSNTPLPA 197
            .:|:   :|.:|.|:...|      .....|.:.:.|.||:  :..||..|:||   .|...:|.
Zfish   133 TSVVVIESPVNPQVVLYVNEQELQDQQEVLEGRSVSLRCSADDLCSSPPATLTW---SSTARIPH 194

  Fly   198 TVLKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPRV-----EV 257
            :  :.....:...:.|:....:......:.|.:..:..:..|...::.||:|.|.|::     .:
Zfish   195 S--ESSKLQELIISDLNFTAAQRHHRVTFTCSISYQLQDNNKTAHSSITLHVQYAPQILNSSCNI 257

  Fly   258 GPENPLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSS---------LVHTIHR------VS 307
            |..|          ...|.||..|. |.|.|:.:||.:|:|         |.:|..|      .|
Zfish   258 GNVN----------VCFCEVDGNPS-PVVEWHLSGRLVSNSSNMFISEERLSNTSLRSFISLDQS 311

  Fly   308 VQDAGKYTCIADNGLGKTGEQEL-----------ILDILYPPMVVIES-------------KTRE 348
            :.......|::.|..|....|.|           ::.:....:|.:.|             :|::
Zfish   312 LTQTSTLLCVSKNTHGNESLQLLPSSTRLSFSFMLIGVAVVLLVTLISVIIYLRKERGKLQQTKQ 376

  Fly   349 AE-------------EGD----TVTIRCNVTANPAPVTIEWLKENSPDFR-YNGDVLTLTSVRAD 395
            .|             |||    ||:...:.||||.....:.:..:|.||: |..:...:.||...
Zfish   377 EESAKGSGQNADKENEGDSLYATVSSVEDATANPDIHRQKSIIYSSIDFKNYKAESEEVESVSCL 441

  Fly   396 HAGNYICRAVNIMQSQGMERSERV----GNSTVALLVRHRPGQAYITPNK 441
            || :|   ||....|.|...:|.:    ..||.|.::.........||.|
Zfish   442 HA-DY---AVVQRDSGGAAEAESLVREFSRSTEAQVIERADKLTKQTPLK 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845 20/108 (19%)
I-set 146..249 CDD:254352 21/113 (19%)
Ig 168..249 CDD:299845 15/82 (18%)
IGc2 268..323 CDD:197706 17/69 (25%)
Ig_3 341..406 CDD:290638 22/95 (23%)
Ig_2 437..514 CDD:290606 3/5 (60%)
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
LOC101884775XP_009298710.1 Ig 22..137 CDD:299845 26/130 (20%)
Ig 154..230 CDD:299845 13/80 (16%)
IG_like 158..244 CDD:214653 16/90 (18%)
DUF499 276..>493 CDD:303008 47/216 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.