DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC101882982

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_009293582.1 Gene:LOC101882982 / 101882982 -ID:- Length:492 Species:Danio rerio


Alignment Length:412 Identity:97/412 - (23%)
Similarity:165/412 - (40%) Gaps:83/412 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LIALVALSSTTLADESID-------TRENADLTLKCRFNDKYEANDFSFFWTRWTANPAQFDNVA 87
            ||.|:.:...:.||..::       ..:|:.:|:.|.|.  |....:......|     ..|.|.
Zfish    13 LIFLLIIHRVSAADWGVNYSPLHLCALKNSTMTISCTFT--YPTPGYQIMTVFW-----NIDFVK 70

  Fly    88 IGEVQLSSGYRLDFQPERGIYDLQIKNVSYNRDNGRFECRIK-AKGTGADVHQEFH----NLTV- 146
            .| |:|:.   |...||   |..:::.:...:.|    |.:: :..|..|.|..|.    |:|. 
Zfish    71 NG-VELAD---LSVDPE---YSQRLQYLGDEQQN----CTVRLSHVTKKDEHDYFFKFNTNVTKG 124

  Fly   147 ---------LTPPHPPVISPGNIAVATEDKPMELTCSSIGGSPD-PTITWYREGSNTPLPATVLK 201
                     |:.....:.||..:   ||...:.|||:|.....| ||..|||...      |:..
Zfish   125 RWTGIPGVRLSVTDLQLESPERV---TEGDSVRLTCNSSCELTDTPTFIWYRNSH------TLTN 180

  Fly   202 GGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPRVEVGPENP---- 262
            .|.:       |:|......:...|.|.|:.:..     :.....|||.|      .|::|    
Zfish   181 IGDE-------LNIRSVSRTEAGHYSCGVQGQTY-----ISPAVYLNVRY------APDSPVISI 227

  Fly   263 ----LRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGKYTCIADNGLG 323
                :.:|.| :..|.|:.|:.|...|..|.:....:.|..:..|.::|..|:|:|.|.|.|.||
Zfish   228 SGSAVIMEGD-SVSLNCSSDSNPPALNFSWFKGETLVGSGGIFNISKISSDDSGEYKCRARNDLG 291

  Fly   324 KTGEQELILDILYPPMVVIESKTREA--EEGDTVTIRCNVTANPAPVTIEWLKENSPDFRYNGDV 386
            :.....:.:|:.|||..::.|.:..|  ..||:||:.|:..:||. ..|.|.|..:  :..:..:
Zfish   292 EKYSDPVTVDVQYPPRSILVSISGSAVIMSGDSVTLSCSSDSNPL-AEINWFKGET--YLNSERI 353

  Fly   387 LTLTSVRADHA-GNYICRAVNI 407
            ..::.:.:|.: ..|.|||.|:
Zfish   354 FNISKISSDDSEEEYKCRARNV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845 23/111 (21%)
I-set 146..249 CDD:254352 23/113 (20%)
Ig 168..249 CDD:299845 18/81 (22%)
IGc2 268..323 CDD:197706 16/54 (30%)
Ig_3 341..406 CDD:290638 17/67 (25%)
Ig_2 437..514 CDD:290606
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
LOC101882982XP_009293582.1 Ig 42..125 CDD:299845 22/100 (22%)
IG_like 143..202 CDD:214653 20/74 (27%)
Ig_2 143..>200 CDD:290606 19/72 (26%)
Ig_2 223..302 CDD:290606 20/79 (25%)
IG_like 228..302 CDD:214653 19/74 (26%)
IG_like 314..381 CDD:214653 17/65 (26%)
IGc2 321..377 CDD:197706 16/58 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.