DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and Kirrel2

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_038957463.1 Gene:Kirrel2 / 100359836 RGDID:1308456 Length:711 Species:Rattus norvegicus


Alignment Length:751 Identity:165/751 - (21%)
Similarity:248/751 - (33%) Gaps:242/751 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 WTRWTANPAQFDNVAI-GEVQLS--SGYRLDFQPERGIYDLQIKNVSYNRDNGRFECRIKAKGTG 134
            ||:        |.:|: ||..|.  |.|.:......|.:||.||.|.. .|...:||:....|..
  Rat    64 WTK--------DGLALGGERDLPGWSRYWISGNSASGQHDLHIKPVEL-EDEASYECQASQAGLR 119

  Fly   135 ADVHQEFHNLTVLTPPHPPVISPGNIAVATEDKPMELTCSSIGGS-PDPTITWYREGSNTPLPAT 198
            :...|    |.|:.||..|.:..|.........|..|||.|.|.: |.|.:.|:|:|        
  Rat   120 SRPAQ----LHVMVPPEAPQVLGGPSVSLVAGVPGNLTCRSRGDARPAPELLWFRDG-------- 172

  Fly   199 VLKGGT-------KDQPTNA---TLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYP 253
            :...||       :|:.|..   ||.:.|..:||||...|..|::|:..|:  :...||::.|.|
  Rat   173 IRLDGTSFHQITLRDKATGTVENTLFLTPSSQDDGATLICRARSQALPTGR--DTAVTLSLQYPP 235

  Fly   254 RVEVGPENPLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGKYT--- 315
            .|.:..|.....|.::...| |...|:|.|...||.:.|..:..:....:..|:  ||...|   
  Rat   236 MVTLSAEPQTAQEGEKVTFL-CQATAQPPVTGYRWAKGGSPVLGARGPRLEVVA--DATFLTEPV 297

  Fly   316 -CIADNGLGKTGEQELILDILYPPMVVIESKTREAEEGDTVTIRCNVTANPAPVTIEWLKENSPD 379
             |...|.:| :..:...|::||.|::..:.|....:.|...:..|....||.| .|.|.:.....
  Rat   298 SCEVSNAVG-SANRSTALEVLYGPILQAKPKPVSVDVGKDASFSCVWRGNPLP-RISWTRLGGSQ 360

  Fly   380 FRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERVGNSTVALLVRHRPGQAYITPNKPVV 444
            ...:|..|.|.||..:.||:|:|||        ..|...||..|         .||.:|.|.|  
  Rat   361 VLSSGPTLRLPSVALEDAGDYVCRA--------EPRRTGVGGGT---------AQARLTVNAP-- 406

  Fly   445 HVGNGVTLTCSANPPGWPVPQYRWFRDMDGEFSSTQKILAQGPQYSIPKAHLGNEGKYHCHAVNE 509
                                                                             
  Rat   407 ----------------------------------------------------------------- 406

  Fly   510 LGIGMMATIVLEIHQPPQFL---AKLQQHMTRRVADTDYTVTCSAKGKPAP-SVKWLKDAVEILP 570
                   .:|..:|..|.||   |:||               |.....||| ||.|..|      
  Rat   407 -------PVVTALHPAPAFLRGPARLQ---------------CVVFASPAPDSVVWSWD------ 443

  Fly   571 EENLYEVQTNPDQGLNGMVTVQSQLKFRGKARPNGNALVPGDR--GLYTCLYQNEVNSA------ 627
                           .|.:...|..:|..:|.|...  |.|.:  ||.:.|:.:....:      
  Rat   444 ---------------EGFLEAGSLGRFLVEAFPAPE--VEGGQGPGLISVLHISGTQESDFTTGF 491

  Fly   628 NSSMQLRIEHEPIVLHQYNKVAFDIRETAEVVCKVQAYPKPEFQ---------WQFGN-----NP 678
            |.|.:.|:....:.:|...:   |:..|..:|....:.....|.         |:.|:     |.
  Rat   492 NCSARNRLGEGRVQIHLGRR---DLLPTVRLVAGAASAATSLFMVITGVVLCCWRHGSLSKQKNL 553

  Fly   679 SPLTMSSDG------HYEISTTTDNNDIYTSVLKINSLTHSDYGEYTCRVANTLDTIRAPIRLQQ 737
            ..:..||:|      ..|..::.|...|          .|:|:.:........|:|         
  Rat   554 VRIPGSSEGSSAHGPEEETGSSEDRGPI----------VHTDHNDLVLEENEALET--------- 599

  Fly   738 KGPPEKPTN----LRATEVGHNYVSLSWDPGFDGGL 769
                :.|||    :|...|.   :||...||  |||
  Rat   600 ----KDPTNGYYKVRGVSVS---LSLGEAPG--GGL 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845 21/76 (28%)
I-set 146..249 CDD:254352 33/113 (29%)
Ig 168..249 CDD:299845 28/91 (31%)
IGc2 268..323 CDD:197706 14/58 (24%)
Ig_3 341..406 CDD:290638 19/64 (30%)
Ig_2 437..514 CDD:290606 3/76 (4%)
I-set 526..633 CDD:254352 26/118 (22%)
Ig 546..632 CDD:143165 20/94 (21%)
IG_like 654..736 CDD:214653 16/101 (16%)
Ig 656..734 CDD:143165 15/97 (15%)
FN3 741..848 CDD:238020 12/33 (36%)
Kirrel2XP_038957463.1 IG_like 38..127 CDD:214653 21/75 (28%)
Ig strand A' 40..44 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand C 62..66 CDD:409353 1/1 (100%)
Ig strand D 75..85 CDD:409353 3/9 (33%)
Ig strand E 88..100 CDD:409353 4/11 (36%)
Ig strand F 107..115 CDD:409353 2/7 (29%)
Ig strand G 117..127 CDD:409353 3/13 (23%)
Ig 133..231 CDD:416386 30/107 (28%)
Ig strand A 134..137 CDD:409353 1/2 (50%)
Ig strand A' 140..144 CDD:409353 0/3 (0%)
Ig strand B 151..158 CDD:409353 4/6 (67%)
Ig strand C 164..169 CDD:409353 1/4 (25%)
Ig strand C' 172..174 CDD:409353 1/9 (11%)
Ig strand D 177..184 CDD:409353 2/6 (33%)
Ig strand E 191..199 CDD:409353 2/7 (29%)
Ig strand F 208..216 CDD:409353 2/7 (29%)
Ig strand G 222..228 CDD:409353 1/7 (14%)
Ig_3 234..303 CDD:404760 17/71 (24%)
Ig strand B 252..256 CDD:409353 1/4 (25%)
Ig strand C 266..270 CDD:409353 1/3 (33%)
Ig strand E 283..286 CDD:409353 0/2 (0%)
Ig strand F 292..301 CDD:409353 2/8 (25%)
Ig strand G 309..312 CDD:409353 0/2 (0%)
Ig 326..403 CDD:416386 25/94 (27%)
Ig strand A' 327..332 CDD:409353 1/4 (25%)
Ig strand B 335..344 CDD:409353 1/8 (13%)
Ig strand C 350..354 CDD:409353 1/3 (33%)
Ig strand C' 357..359 CDD:409353 0/1 (0%)
Ig strand D 362..365 CDD:409353 0/2 (0%)
Ig strand E 366..371 CDD:409353 1/4 (25%)
Ig strand F 379..387 CDD:409353 5/15 (33%)
Ig strand G 393..403 CDD:409353 4/18 (22%)
Ig 405..509 CDD:416386 31/215 (14%)
Ig strand A 406..410 CDD:409353 1/77 (1%)
Ig strand A' 412..415 CDD:409353 1/2 (50%)
Ig strand B 423..430 CDD:409353 4/21 (19%)
Ig strand C 437..442 CDD:409353 3/4 (75%)
Ig strand C' 444..447 CDD:409353 1/2 (50%)
Ig strand D 455..462 CDD:409353 2/6 (33%)
Ig strand E 472..479 CDD:409353 3/6 (50%)
Ig strand F 490..497 CDD:409353 2/6 (33%)
Ig strand G 500..507 CDD:409353 0/6 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.