DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and kirrel2

DIOPT Version :10

Sequence 1:NP_523469.2 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:NP_001135598.1 Gene:kirrel2 / 100216155 XenbaseID:XB-GENE-854070 Length:780 Species:Xenopus tropicalis


Alignment Length:471 Identity:132/471 - (28%)
Similarity:201/471 - (42%) Gaps:78/471 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RWTANPAQFDNVAIG-EVQLS--SGYRLDFQPERGIYDLQIKNVSYNRDNGRFECRIKAKGTGAD 136
            :||     .|.:|:| |..|.  |.|.:...|..|.::|.|:.|..: |:..:||    :.|.|.
 Frog    53 QWT-----MDGLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELS-DDAIYEC----QATQAA 107

  Fly   137 VHQEFHNLTVLTPPHPPVISPGNIAVATEDKPMELTCSSIGGSPDPTITWYREGSNTPLPATV-- 199
            :..:...||||.||..|:|....:|....:.|..|||.:....|...|||||:|..  |.:.|  
 Frog   108 LRSQRARLTV
LLPPGDPMIPGSPVANVLLNVPYNLTCLAPVAKPAAEITWYRDGKK--LDSAVYT 170

  Fly   200 --LKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPRVEVGPENP 262
              |....|.:.:.::|.|.|...|.|:.|.|.|||.|:.||:  |.:.||:|.|.|:|.:..|.|
 Frog   171 KELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNEALPEGR--EKSVTLSV
QYPPKVTLSVEPP 233

  Fly   263 LRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSS-------LVHTIHRVSVQDAGKYTCIADN 320
            ...|......| |...:.|:|...||.:.|..::.|       :.||.....|      :|...|
 Frog   234 TITEGGSVTFL-CGAVSNPEVTGYRWAKGGVPLAVSGDKYTVEVDHTFFTAPV------SCEVSN 291

  Fly   321 GLGKTGEQELILDILYPPMVVIESKTREAEEGDTVTIRCNVTANPAPVTIEWLKENSPDFRYNGD 385
            .:|.:.....: ::|:.|.::.|.:....:.||..:..|..|.||.| |..|.|:.:.:...||:
 Frog   292 SVGASNVSTAV-NVLFGPRLLTEPRPMTVDIGDDASFFCGWTGNPTP-TQFWSKKGTGEVLSNGN 354

  Fly   386 VLTLTSVRADHAGNYICRAVNIMQSQGMERSERVGNSTVALLVRHRPGQAYITPNKPVVH----V 446
            .|.||.|..:.||.|:|:|  |:...|....|      |.|.||   |...||..   :|    :
 Frog   355 TLLLTKVTREDAGIYVCKA--IVPRMGSTEKE------VTLTVR---GPPIITSE---MHYETTL 405

  Fly   447 GNGVTLTCSANPPGWPVP-QYRWFRDMD-------GEFSSTQKILAQGPQYSIPKAHLGNEG--- 500
            |....:.|...  ..|.| :..|..|..       |.||...::...| ..|:    |..:|   
 Frog   406 GGKARMECLIE--STPAPDRIVWAWDKQSLEDGSWGRFSVETEVTEVG-AISV----LVIDGAEQ 463

  Fly   501 -----KYHCHAVNELG 511
                 :::|.|:|:.|
 Frog   464 SDFLTEFNCSAINQYG 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_523469.2 V-set 50..147 CDD:462230 21/74 (28%)
Ig 153..249 CDD:472250 34/99 (34%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 183..187 CDD:409353 2/3 (67%)
Ig strand E 211..215 CDD:409353 1/3 (33%)
Ig strand F 225..230 CDD:409353 2/4 (50%)
Ig strand G 242..245 CDD:409353 1/2 (50%)
Ig_3 253..320 CDD:464046 17/73 (23%)
Ig_3 337..406 CDD:464046 23/68 (34%)
Ig_2 437..>504 CDD:464026 16/86 (19%)
Ig 525..635 CDD:472250
Ig strand B 545..549 CDD:409568
Ig strand C 558..562 CDD:409568
Ig strand E 587..591 CDD:409568
Ig strand F 615..620 CDD:409568
Ig strand G 628..631 CDD:409568
Ig_3 639..724 CDD:464046
FN3 741..848 CDD:238020
kirrel2NP_001135598.1 IG_like 28..117 CDD:214653 20/73 (27%)
Ig strand B 39..43 CDD:409353
Ig strand C 51..55 CDD:409353 0/1 (0%)
Ig strand E 79..82 CDD:409353 1/2 (50%)
Ig strand F 98..103 CDD:409353 2/8 (25%)
Ig strand G 110..113 CDD:409353 0/2 (0%)
IgI_2_KIRREL3-like 123..220 CDD:409416 34/100 (34%)
Ig strand A 124..127 CDD:409416 1/2 (50%)
Ig strand A' 130..134 CDD:409416 1/3 (33%)
Ig strand B 141..148 CDD:409416 3/6 (50%)
Ig strand C 153..158 CDD:409416 2/4 (50%)
Ig strand C' 161..163 CDD:409416 1/1 (100%)
Ig strand D 166..173 CDD:409416 1/6 (17%)
Ig strand E 180..188 CDD:409416 1/7 (14%)
Ig strand F 197..205 CDD:409416 3/7 (43%)
Ig strand G 211..217 CDD:409416 2/7 (29%)
Ig_2 225..304 CDD:464026 18/86 (21%)
Ig 308..389 CDD:472250 28/89 (31%)
Ig strand B 325..329 CDD:409353 0/3 (0%)
Ig strand C 338..342 CDD:409353 1/3 (33%)
Ig strand E 354..358 CDD:409353 1/3 (33%)
Ig strand F 368..373 CDD:409353 2/4 (50%)
Ig strand G 382..385 CDD:409353 1/8 (13%)
Ig 391..488 CDD:472250 21/99 (21%)
Ig strand B 409..413 CDD:409353 0/3 (0%)
Ig strand C 423..427 CDD:409353 0/3 (0%)
Ig strand E 454..458 CDD:409353 2/7 (29%)
Ig strand F 469..474 CDD:409353 1/4 (25%)
Ig strand G 482..485 CDD:409353
Atrophin-1 536..>730 CDD:460830
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.