DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC100150424

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_017211411.2 Gene:LOC100150424 / 100150424 -ID:- Length:507 Species:Danio rerio


Alignment Length:470 Identity:108/470 - (22%)
Similarity:173/470 - (36%) Gaps:120/470 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LIALVALSSTTLAD-------ESIDTRENADLTLKCRFNDKYEANDFSF---FWTRWTANPAQFD 84
            ||.|:.:...:.||       ..|...:|:.:|:.|.|.  |....:..   ||.:        |
Zfish    13 LIFLLIIHRVSAADWGVIYNPSQICALQNSTMTISCTFT--YPTPGYQIMKVFWNK--------D 67

  Fly    85 NVAIGE--VQLSSGYRLDFQPERGIYDLQIKNVSYNRDNGRFECRIK-AKGTGADVHQEFHNLTV 146
            .|..|.  ..||.      .||   |..:::.:...:.|    |.:: :..|..|.|:.....|.
Zfish    68 QVYYGGEFADLSE------DPE---YSQRLQYLGDKQQN----CTVRLSHVTEKDEHEYLFRFTT 119

  Fly   147 --------------LTPPHPPVISPGNIAVATEDKPMELTCS-SIGGSPDPTITWYREGSNTPLP 196
                          |:.....:.||..:   ||...:.|||. |...:..||..|||...     
Zfish   120 DVTGGIWLGKPGVRLSVTDLQLESPERV---TEGDSVRLTCKRSCKLTDTPTFIWYRNSH----- 176

  Fly   197 ATVLKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPRVEVGPEN 261
             |:...|.:     ..:|.:.|.|  ...|.|.|:.:..     :.....||:.|      ||:.
Zfish   177 -TLTNIGEE-----LNISSVSRTE--AGHYSCGVQGQTY-----ISPAVYLNITY------GPDT 222

  Fly   262 P--------LRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGKYTCIA 318
            |        :.||.| :..|.|:.|:.|...:..|.:....:.|..:..|.::|..|:|:|.|.|
Zfish   223 PVISISGSAVIVEGD-SVTLNCSSDSNPPALSFSWFKEATSVGSGRIFNISKISSDDSGEYKCRA 286

  Fly   319 DNGLGKTGEQELILDILYPPMVVIESKTREAEE--GDTVTIRCNVTANPAPVTIEWLK-ENSPDF 380
            .|..|......:.||:.|||..|..|.:..|.:  ||:|::.|:..:||..:...|.| |.|.  
Zfish   287 RNDHGVNDSDPVTLDVQYPPKSVSVSISGSAVKMFGDSVSLSCSSDSNPPALNFSWYKGETSV-- 349

  Fly   381 RYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERVGNSTVALLVRHRPGQAYITPNKPVVH 445
             .:|.:|.::.:   .:|::.|...|   ..|.:||:.|   ||                  .||
Zfish   350 -RSGRILNISKI---SSGHFHCETHN---PHGAQRSDAV---TV------------------TVH 386

  Fly   446 VGNGVTLTCSANPPG 460
            .|.|..:...|...|
Zfish   387 QGAGRNIIIIAATSG 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845 21/116 (18%)
I-set 146..249 CDD:254352 23/117 (20%)
Ig 168..249 CDD:299845 18/81 (22%)
IGc2 268..323 CDD:197706 15/54 (28%)
Ig_3 341..406 CDD:290638 17/67 (25%)
Ig_2 437..514 CDD:290606 6/24 (25%)
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
LOC100150424XP_017211411.2 Ig 27..117 CDD:325142 21/112 (19%)
IGc2 149..200 CDD:197706 16/63 (25%)
Ig_2 223..302 CDD:316418 20/79 (25%)
Ig_2 <334..385 CDD:316418 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.