DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC100149229

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_021333810.1 Gene:LOC100149229 / 100149229 -ID:- Length:335 Species:Danio rerio


Alignment Length:441 Identity:91/441 - (20%)
Similarity:145/441 - (32%) Gaps:138/441 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RAATTICNFFLIALVALS----STTLADESIDTRENADLTLKCRFNDKYEANDFSFFWTRWTANP 80
            |.|..:...||:.:..:|    ||......|...:|:.:|:.|.|...........||.:   |.
Zfish     6 RMAPALHLIFLLIIHRVSAAEWSTKYNATEICALQNSTMTISCTFTHPEGLQIMRAFWNK---NE 67

  Fly    81 AQFDNVAIGEVQLSSGYRLDFQPERGIYDLQIKNVSYNRDNGRFECRIKAKGTGADVHQEFHNLT 145
            .:.|    ||:.     .|...||   |..:::.:...:.|.....   :..|..|.|:.:..:|
Zfish    68 VKHD----GELT-----DLSEDPE---YSQRLQYLGDKQHNRTVRL---SHVTKKDEHEYYFRIT 117

  Fly   146 VLTPPHPPVISPG-NIAV----------ATEDKPMELTC-SSIGGSPDPTITWYREGSNTPLPAT 198
            ........:..|| .::|          .||...:.||| ||...:..||..|||...      |
Zfish   118 TNVSAQKWLGKPGVRLSVTDLQLESPERVTEGDSVRLTCKSSCKLTDTPTFIWYRNSH------T 176

  Fly   199 VLKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRA-MNEGKRLEATAT-LNVNYYPRVEVGPEN 261
            :...|.:       |:|......:...|.|.|:.:. ::....|:.|.. |:|           .
Zfish   177 LTNIGDE-------LNIRSVSRTEAGHYSCGVQGQMYISPAVYLDVTCKFLSV-----------L 223

  Fly   262 PLRVERDRTAKLECNVDA-----KPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGKYTCIADNG 321
            |..|...:|.:|..|:.|     .|..|.:       |:|.|.:                     
Zfish   224 PFSVYLFKTYRLTINMKAVELKNAPDTPVI-------FLSGSAI--------------------- 260

  Fly   322 LGKTGEQELILDILYPPMVVIESKTREAEEGDTVTIRCNVTANPAPVTIEWLKENSPDFRYNGDV 386
                                       .:|||:||:.|...:||..:...|.:||......:|. 
Zfish   261 ---------------------------IKEGDSVTLMCISHSNPPALNFSWFEENQSSAVGSGQ- 297

  Fly   387 LTLTSVRADHAGNYICRAVNIMQSQGMERSERVGNSTVALLVRHRPGQAYI 437
                |..|..:|.:.|.|.|   ..|.:||:.|   ||.       |:|:|
Zfish   298 ----SFSAVQSGRFYCEAHN---PHGAQRSDAV---TVT-------GEAFI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845 19/96 (20%)
I-set 146..249 CDD:254352 25/116 (22%)
Ig 168..249 CDD:299845 20/83 (24%)
IGc2 268..323 CDD:197706 9/59 (15%)
Ig_3 341..406 CDD:290638 17/64 (27%)
Ig_2 437..514 CDD:290606 1/1 (100%)
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
LOC100149229XP_021333810.1 Ig 40..136 CDD:325142 21/113 (19%)
Ig_3 142..199 CDD:316449 17/69 (25%)
Ig_2 251..326 CDD:316418 27/140 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.