DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC100148735

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_001919202.4 Gene:LOC100148735 / 100148735 -ID:- Length:440 Species:Danio rerio


Alignment Length:423 Identity:103/423 - (24%)
Similarity:172/423 - (40%) Gaps:68/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RAATTICNFFLIALVALSS----TTLADESIDTRENADLTLKCRF---NDKYEANDFSFFWTRWT 77
            |.|..:...||:.:..:|:    ...:...|...:|:.:|:.|.|   |.:|:.  ...||.:  
Zfish     6 RMAPALHLIFLLIIHRVSAAGWGVNYSPSHICALQNSTMTISCTFTYPNTEYQI--MKVFWNK-- 66

  Fly    78 ANPAQFDNVAIGEVQLSSGYRLDFQPERGIYDLQIKNVSYNRDNGRFECRIK-AKGTGADVHQEF 141
                  |.|..| |:.:.   |...||   |..:::.:...:.|    |.|: :..|..|..|.:
Zfish    67 ------DQVYNG-VEFAD---LSEDPE---YSQRLQYLGDKQQN----CTIRLSHVTKKDEGQYY 114

  Fly   142 HNLTVLTPPHPPVISPGNIAVATE---DKP--------MELTC-SSIGGSPDPTITWYREGSNTP 194
            ...|...........||.|...||   :.|        :.||| ||...:..||..|||...   
Zfish   115 FRFTTNVANQKWTGIPGVILSVTELQLESPERVKEGDSVRLTCRSSCKLTDTPTFIWYRNSH--- 176

  Fly   195 LPATVLKGGTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPR-VEVG 258
               |:...|.:       |:|.|....|..:|:|.|....:...:     ..|||.|.|: :.|.
Zfish   177 ---TLTNIGDE-------LNISPVSRGDAGRYRCAVHGHTLTSPE-----VYLNVMYPPKSISVS 226

  Fly   259 PENPLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGKYTCIADNGLG 323
            ......:....:..|.|:.|:.|.. .:.|.:....:.|..:..|.::|..|:|:|.|.|.|..|
Zfish   227 ISGSAVIMSGDSVTLSCSSDSNPPA-EINWYKGKTSVRSGRILNISKISSDDSGEYKCRARNAHG 290

  Fly   324 KTGEQELILDILYPPMVVIESKTREAE--EGDTVTIRCNVTANPAPVTIEWLKENSPDFRYNGDV 386
            :.....:.||:.|||..|..|.:..|.  .||:||:.|:..:||..:...|.|..:  ...:|.:
Zfish   291 EKYSDPVTLDVQYPPRSVSVSISGSAVIISGDSVTLSCSSDSNPPALNFSWFKGET--LVGSGRI 353

  Fly   387 LTLTSVRADHAGNYICRAVNIMQSQGMERSERV 419
            .:::::.:|.:|.|.|||.|:   .|.:.|:.|
Zfish   354 FSISNISSDDSGEYKCRAGNV---HGEKHSDPV 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845 23/100 (23%)
I-set 146..249 CDD:254352 26/114 (23%)
Ig 168..249 CDD:299845 21/89 (24%)
IGc2 268..323 CDD:197706 14/54 (26%)
Ig_3 341..406 CDD:290638 19/66 (29%)
Ig_2 437..514 CDD:290606
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
LOC100148735XP_001919202.4 Ig 27..127 CDD:299845 24/120 (20%)
IG_like 143..216 CDD:214653 21/90 (23%)
IGc2 149..205 CDD:197706 19/68 (28%)
IG_like 228..301 CDD:214653 16/73 (22%)
Ig_2 232..301 CDD:290606 16/69 (23%)
IG_like 305..387 CDD:214653 24/84 (29%)
Ig_2 321..387 CDD:290606 20/68 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.