DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC100147925

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_021333837.1 Gene:LOC100147925 / 100147925 -ID:- Length:364 Species:Danio rerio


Alignment Length:430 Identity:95/430 - (22%)
Similarity:157/430 - (36%) Gaps:134/430 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PPVISPGNIAV--------ATEDKPMELTCS--SIGGSPDPTITWYREGSNTPLPATVLKG---- 202
            |.|.|.|..||        |.:|..:.::|:  ...|....|..|.:.......|..:.|.    
Zfish    15 PDVFSEGEWAVHYSSSHICALKDSSVIMSCTYKYPAGHQIITAFWNKGFVKNGEPPDLSKDPEYS 79

  Fly   203 ------GTKDQPTNATLSIIPRRED-----------DGAKYKCVVRNRAMNEGKRLEATATLNVN 250
                  |.|.|.....||.:.:::.           .|.:|..:       .|.||..|      
Zfish    80 QRLQYLGDKQQNCTIRLSHVTKKDKHEYYFRFITDVTGGRYTGI-------PGVRLSVT------ 131

  Fly   251 YYPRVEVGPENPLRV-ERDR---TAKLECNVDAKPKVPNVRWNRNGRFISSS------LVHTIHR 305
                 ::..|:|.|| |||.   |.|..||:   ...|...|.||.:.::..      :::::.|
Zfish   132 -----DLQLESPERVTERDSVRLTCKSSCNL---TDTPTFIWYRNSQRLTEGTTDNKLILNSVRR 188

  Fly   306 VSVQDAGKYTCIADNGLGKTGEQELILDILYPPMVVIESKTREAEEGDTVT-------IRCNVTA 363
               :|||:|.|                                |..|.|:|       :.|:..:
Zfish   189 ---EDAGRYRC--------------------------------AVHGHTLTSPDVYLDVTCDSDS 218

  Fly   364 NPAPVTIEWLK-ENSPDFRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERVGNSTVALL 427
            || |..|.|.| |.|..|   |.:.:::.:.:|.:|.|.|||.|   ..|.:.|:     .|.|.
Zfish   219 NP-PAEINWFKGETSVGF---GRIFSISKISSDDSGEYKCRATN---EHGGKHSD-----LVTLD 271

  Fly   428 VRHRPGQAYITPN-KPVVHVGNGVTLTC--SANPPGWPVPQYRWFRDMDGEFSSTQKILAQGPQY 489
            |::.|....::.| ..|:..|:.|:|.|  .:|||..   .:.||::      :....:..|..:
Zfish   272 VQYSPRSTSVSINGSAVIMSGDSVSLMCISDSNPPAL---NFSWFKE------NQSSAVGSGQSF 327

  Fly   490 SIPKAHLGNEGKYHCHAVNELGIGMMATIVLEIHQPPQFL 529
            |..::     |:::|.|.|..|....|.:.:.:....|.|
Zfish   328 SAVQS-----GRFYCEAHNPHGAQRSAAVTVTVRGVYQHL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845
I-set 146..249 CDD:254352 25/127 (20%)
Ig 168..249 CDD:299845 17/103 (17%)
IGc2 268..323 CDD:197706 15/63 (24%)
Ig_3 341..406 CDD:290638 21/72 (29%)
Ig_2 437..514 CDD:290606 18/79 (23%)
I-set 526..633 CDD:254352 2/4 (50%)
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
LOC100147925XP_021333837.1 Ig 30..111 CDD:325142 13/80 (16%)
Ig_3 137..196 CDD:316449 19/64 (30%)
Ig_2 209..272 CDD:316418 22/74 (30%)
Ig_2 286..355 CDD:316418 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.