DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ed and LOC100006649

DIOPT Version :9

Sequence 1:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster
Sequence 2:XP_021333396.1 Gene:LOC100006649 / 100006649 -ID:- Length:507 Species:Danio rerio


Alignment Length:430 Identity:106/430 - (24%)
Similarity:175/430 - (40%) Gaps:69/430 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IVNSRSARRAATTICNFFLIALVALSS--TTLADESIDTRENADLTLKCRFNDKYEANDFSFFWT 74
            :|...|.|.|...:. |.:|.:|:.:.  .....|.|...:::.:.:.|.:.........:.|||
Zfish     1 MVRMMSVRIALLPLI-FLMIHIVSSADWCVKYTPEHICALKSSTVIMSCTYKYPKSHKVRTAFWT 64

  Fly    75 RWTANPAQFDNVAIGEVQLSSGY-RLDFQPERGIYDLQIKNVSYNRDNGRFECRIK-AKGTGADV 137
            ::.....|             .| .|...||   |..:::.:...:.|    |.:: :..|..|.
Zfish    65 KYPPKQGQ-------------EYPDLSEDPE---YSQRLQYLGDKQQN----CHLRLSHVTKKDE 109

  Fly   138 HQEFHNLTVLTPPHPPVISPG-NIAV----------ATEDKPMELTC-SSIGGSPDPTITWYREG 190
            ||.:...|........:.:|| .::|          .||...:.||| ||...:..||..|||. 
Zfish   110 HQYYFRFTTNVTGKMWLGTPGVRLSVTDLQLESPERVTEGDSVRLTCKSSCKLTDTPTFIWYRN- 173

  Fly   191 SNTPLPATVLKG--GTKDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATAT-LNVNYY 252
                  :..|.|  |.|       |.:.|.|.:|..:|.|.|      :|..|.:... |||.|.
Zfish   174 ------SVTLTGKIGNK-------LILNPVRREDAGRYSCGV------DGHTLTSPEVYLNVTYP 219

  Fly   253 PR-VEVGPENPLRVERDRTAKLECNVDAKPKVPNVRWNRNGRFISSSLVHTIHRVSVQDAGKYTC 316
            |: |.........:....:..|.|:.|:.|...|..|.:...|:.|..:..|.::|..|:|:|.|
Zfish   220 PKNVSASLNGSAVIMSGDSVTLSCSSDSNPPALNFSWYKGETFVGSGRIFNISKISSDDSGEYKC 284

  Fly   317 IADNGLGKTGEQELILDILYPPMVVIESKTREAE--EGDTVTIRCNVTANPAPVTIEWLKENSPD 379
            .|.|..|:.....:.||:.|.|..:..|....||  |||:||:.|:..:|| |..:.|.|.|.. 
Zfish   285 RARNKHGEKYSDPVTLDVQYSPKSISVSINGSAEIVEGDSVTLNCSSDSNP-PAELNWFKGNKS- 347

  Fly   380 FRYNGDVLTLTSVRADHAGNYICRAVNIMQSQGMERSERV 419
             ..:|.:..::.:.:|.:|.|.|:|.|   :.|::.|:.|
Zfish   348 -LNSGRLFNISKISSDDSGEYKCKAKN---AHGVKYSDPV 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
edNP_001260013.1 Ig 50..147 CDD:299845 17/98 (17%)
I-set 146..249 CDD:254352 29/117 (25%)
Ig 168..249 CDD:299845 24/84 (29%)
IGc2 268..323 CDD:197706 16/54 (30%)
Ig_3 341..406 CDD:290638 21/66 (32%)
Ig_2 437..514 CDD:290606
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
LOC100006649XP_021333396.1 Ig 33..116 CDD:325142 18/102 (18%)
Ig_3 142..200 CDD:316449 21/71 (30%)
Ig_2 230..302 CDD:316418 18/71 (25%)
Ig_2 316..387 CDD:316418 24/74 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35531at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.