DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43773 and CG43774

DIOPT Version :10

Sequence 1:NP_001137789.1 Gene:CG43773 / 33617 FlyBaseID:FBgn0264295 Length:75 Species:Drosophila melanogaster
Sequence 2:NP_608816.2 Gene:CG43774 / 14462693 FlyBaseID:FBgn0264296 Length:95 Species:Drosophila melanogaster


Alignment Length:71 Identity:46/71 - (64%)
Similarity:56/71 - (78%) Gaps:9/71 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDININLKCAECNHPRGVLYYANPLAWGRPCRQCRRMMSRN--VVVVP-TQVAVPVATNNNITT 62
            ::::|||::| ||.|.||:||||||||||||||:||||||||  ||.|| .|:||||.     ||
  Fly     4 VNNVNINVQC-ECYHRRGLLYYANPLAWGRPCRKCRRMMSRNNIVVSVPANQMAVPVQ-----TT 62

  Fly    63 TTTFVP 68
            |||.:|
  Fly    63 TTTVMP 68

Return to query results.
Submit another query.