DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and CD22

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_001762.2 Gene:CD22 / 933 HGNCID:1643 Length:847 Species:Homo sapiens


Alignment Length:765 Identity:171/765 - (22%)
Similarity:269/765 - (35%) Gaps:209/765 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TEHYDSTDFTFYWARWTCCPTLFENVAIGDV-----------QLNSNYRLDFRPSRGIYDLQIKN 93
            |..:|.|             .|:|:...|.|           ..|.|..|...|           
Human    68 TSKFDGT-------------RLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHP----------- 108

  Fly    94 TSYNRDNGRFECRIKAKGTGADVHQEFYNLTVLTAPHPPMV-TPGNLAVATEEKPLELTC---SS 154
             .:..|:|:...|:::|   .:...|..:|.|...|.||.: .|..:   .|.:.:.|||   .|
Human   109 -VHLNDSGQLGLRMESK---TEKWMERIHLNVSERPFPPHIQLPPEI---QESQEVTLTCLLNFS 166

  Fly   155 IGGSPDPMITWYREGSTVPLQSYALKGGS---KNHYTNATLQIVPRRADDGAKYKCVVWNRAMPE 216
            ..|.| ..:.|..||  ||::..|:...|   |:.:|.:.|:..|:.:..|....|.:.:   .:
Human   167 CYGYP-IQLQWLLEG--VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQD---AD 225

  Fly   217 GHMLET-SVTLNVNYYPRVE--VGPQNPLKVERDHVAKLDCRV-DAKPMVSNVRWSRNGQYVSAT 277
            |..|.. :|.|||.:.|::|  |.|.:.:..|.|.|. :.|.| .:.|..:.|.|.::|..:...
Human   226 GKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVT-MTCEVSSSNPEYTTVSWLKDGTSLKKQ 289

  Fly   278 PTHT--IYRVNRHHAGKYTCSADNGLGKTGEKDIVLDVLYPPIVFIESKTHE-----AEEGETVL 335
            .|.|  :..|.:..:|||.|...|.:|....:::.|.|.|.|    |..|.:     |.||..|.
Human   290 NTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAP----EPSTVQILHSPAVEGSQVE 350

  Fly   336 IRCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVNIMQPFSSKRVEGVG- 399
            ..|...|||.|.|..|...|......|.|.:.:..:...|||.|.|.:.||:         |.| 
Human   351 FLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENIL---------GTGQ 406

  Fly   400 -NSTVALLVRHRPGQAYITPNKPV-VHVGNGVTLTCSANPPGWPVPQYRWFRDMDGDIGNTQKIL 462
             .....|.|::.|.:.......|: :..|:.|||:|:.|.....|.:|.|               
Human   407 RGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEW--------------- 456

  Fly   463 AQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAVT 527
                     |.|...|..       .||:.||                      :.||..:..:.
Human   457 ---------KPHGAWEEP-------SLGVLKI----------------------QNVGWDNTTIA 483

  Fly   528 CSAKGKPTPQIRWIKDGTEILPTRKMFDIRTTPTDA------------GGGVVAVQSIL------ 574
            |:|...      |....:.:     ..:::..|.|.            .|..|::|...      
Human   484 CAACNS------WCSWASPV-----ALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPK 537

  Fly   575 ----------RFRGK-ARPNGNQLLPNDRGLYTCLYENDV-NSANSSMHLRIEHEPIVIHQYNKV 627
                      |..|| ::.|.:.:.|.|.|.|:|...|.: .:|:.:..|.:.:.|..:......
Human   538 EVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSP 602

  Fly   628 AYDLRE--SAEVVCRVQAYPK-PEFQWQYGNNPS-PLTMSSDGHYEISTRMENNDVYTSILRIAH 688
            ...:.|  ||.:.|...|.|. ..:.|...||.| |       ::....|:|.          ..
Human   603 GDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLP-------YHSQKLRLEP----------VK 650

  Fly   689 LQHSDYGEYICRAVNPLDSIRAPI-RLQPKGSPEKPTNLKILEVGHNYAV 737
            :|||  |.|.|:..|.:...|:|: .|....|||        .:|...||
Human   651 VQHS--GAYWCQGTNSVGKGRSPLSTLTVYYSPE--------TIGRRVAV 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250 26/103 (25%)
Ig strand B 148..152 CDD:409353 1/3 (33%)
Ig strand C 162..166 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 1/4 (25%)
Ig strand G 221..224 CDD:409353 0/3 (0%)
Ig 238..313 CDD:472250 20/77 (26%)
Ig strand B 250..254 CDD:409353 0/3 (0%)
Ig strand C 264..268 CDD:409353 1/3 (33%)
Ig strand E 278..282 CDD:409353 2/5 (40%)
Ig strand F 292..297 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Ig_3 316..385 CDD:464046 22/73 (30%)
Ig_2 416..501 CDD:464026 17/85 (20%)
Ig 523..614 CDD:472250 20/120 (17%)
Ig strand B 524..528 CDD:409568 0/3 (0%)
Ig strand C 537..541 CDD:409568 0/3 (0%)
Ig strand E 566..570 CDD:409568 1/3 (33%)
Ig strand F 594..599 CDD:409568 2/4 (50%)
Ig strand G 607..610 CDD:409568 0/2 (0%)
Ig_3 618..703 CDD:464046 20/88 (23%)
FN3 720..838 CDD:238020 5/18 (28%)
CD22NP_001762.2 IgV_CD22_d1 24..137 CDD:409523 17/96 (18%)
FR1 24..47 CDD:409523
Ig strand A 24..28 CDD:409523
Ig strand A' 31..35 CDD:409523
Ig strand B 37..48 CDD:409523
CDR1 48..54 CDD:409523
Ig strand C 54..61 CDD:409523
FR2 55..61 CDD:409523
CDR2 62..89 CDD:409523 7/33 (21%)
Ig strand C1 63..66 CDD:409523
Ig strand C2 69..73 CDD:409523 0/3 (0%)
Ig strand C' 77..80 CDD:409523 1/2 (50%)
FR3 90..123 CDD:409523 7/44 (16%)
Ig strand D 91..95 CDD:409523 0/3 (0%)
Ig strand E 100..108 CDD:409523 2/7 (29%)
Ig strand F 115..123 CDD:409523 2/7 (29%)
CDR3 124..126 CDD:409523 1/4 (25%)
FR4 127..137 CDD:409523 2/9 (22%)
Ig strand G 127..137 CDD:409523 2/9 (22%)
IgC1_CD22_d2 141..238 CDD:409532 27/105 (26%)
Ig strand A 143..148 CDD:409532 1/4 (25%)
Ig strand B 156..164 CDD:409532 3/7 (43%)
Ig strand C 172..178 CDD:409532 1/5 (20%)
Ig strand C' 180..183 CDD:409532 2/4 (50%)
Ig strand D 188..194 CDD:409532 1/5 (20%)
Ig strand E 198..207 CDD:409532 2/8 (25%)
Ig strand F 215..223 CDD:409532 1/7 (14%)
Ig strand G 228..236 CDD:409532 2/7 (29%)
IgC2_CD22_d3 242..329 CDD:409531 24/87 (28%)
Ig strand A 242..249 CDD:409531 2/6 (33%)
Ig strand A' 253..257 CDD:409531 0/3 (0%)
Ig strand B 258..268 CDD:409531 3/10 (30%)
Ig strand C 275..281 CDD:409531 2/5 (40%)
Ig strand C' 283..286 CDD:409531 1/2 (50%)
Ig strand E 292..298 CDD:409531 1/5 (20%)
Ig strand F 305..313 CDD:409531 4/7 (57%)
Ig strand G 316..329 CDD:409531 3/12 (25%)
Ig_3 335..400 CDD:464046 20/64 (31%)
Ig 499..591 CDD:472250 17/91 (19%)
Ig strand B 525..529 CDD:409531 1/3 (33%)
Ig strand C 540..544 CDD:409531 0/3 (0%)
Ig strand E 555..558 CDD:409531 0/2 (0%)
Ig strand F 568..573 CDD:409531 2/4 (50%)
Ig strand G 582..585 CDD:409531 0/2 (0%)
IG_like 606..677 CDD:214653 23/89 (26%)
Ig strand B 612..616 CDD:409531 1/3 (33%)
Ig strand C 626..630 CDD:409531 0/3 (0%)
Ig strand E 642..646 CDD:409531 0/3 (0%)
Ig strand F 656..661 CDD:409531 2/4 (50%)
Ig strand G 670..673 CDD:409531 1/2 (50%)
ITIM motif 1 760..765
ITIM motif 2 794..799
ITIM motif 3 820..825
ITIM motif 4 840..845
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.