DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and FOL3

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_013831.1 Gene:FOL3 / 855140 SGDID:S000004719 Length:427 Species:Saccharomyces cerevisiae


Alignment Length:436 Identity:88/436 - (20%)
Similarity:151/436 - (34%) Gaps:160/436 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 EHAGNYICRSVNIMQPFSSKRV------EGVGN-----STVALLVRHRPGQAYITPNKPVVHVGN 427
            ||.||          |.:|.||      .|.|:     |:|.....::.|: :.||:  :|||.:
Yeast    15 EHLGN----------PQNSLRVLHIAGTNGKGSVCTYLSSVLQQKSYQIGK-FTTPH--LVHVTD 66

  Fly   428 GVTLTCSANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAH----------LGSEGKY- 481
            .:|:.      ..|:|..|:           |.|..|  ..::.|:|          ..:..|| 
Yeast    67 SITIN------NKPIPLERY-----------QNIRLQ--LEALNKSHSLKCTEFELLTCTAFKYF 112

  Fly   482 ---HCH-AVNELGIG-----------------KIATIILEVHQPPQFLAKLQQHMTRRVGDVDYA 525
               .|. .|.|:|:|                 .|..|.|: |:  .||......:::....:   
Yeast   113 YDVQCQWCVIEVGLGGRLDATNVIPGANKACCGITKISLD-HE--SFLGNTLSEISKEKAGI--- 171

  Fly   526 VTCSAKGKPTPQIRWIKDGTEILPTRKMFDIRTTPTDAGGGVVAVQSILRFRGKA---------- 580
            :|   :|.|...|    |||                    ...:|.::::.|.||          
Yeast   172 IT---EGVPFTVI----DGT--------------------NEASVINVVKERCKALGSELSVTDS 209

  Fly   581 RPNGNQLLPNDRGLYTCLYENDVNSANSSMHLRIEHEPIVIHQYNKVAYDLRESAEVVCRVQA-- 643
            :.|||.:..|..|.:. |.:..:|......:||:....:...|.|:: .|:.:: ||..|:..  
Yeast   210 QLNGNMIDTNSWGCFD-LAKLPLNGEYQIFNLRVAMGMLDYLQMNEL-IDITKN-EVSTRLAKVD 271

  Fly   644 YPKPEFQWQY-----GNNPSPLTMSSDGHYEISTRME---------NNDVYTSILRIAHLQHSDY 694
            :|...::..|     .|...|:.|  ||.:..|..:|         .|...|.::.:.|.::   
Yeast   272 WPGRLYRMDYRFDKVSNRTVPILM--DGAHNGSAAVELVKYLRKEYGNQPLTFVMAVTHGKN--- 331

  Fly   695 GEYICRAVNPLDSIRAPIRLQPKGSPEKPTNLKILEVGHNYAVLNW 740
                   :.||        |||.   .:|.:..||...:|...:.|
Yeast   332 -------LEPL--------LQPL---LRPIDQVILTRFNNVEGMPW 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653
Ig 147..228 CDD:299845
I-set 232..313 CDD:254352
IGc2 250..302 CDD:197706
IG_like 323..385 CDD:214653 4/10 (40%)
IGc2 330..385 CDD:197706 4/10 (40%)
Ig_2 416..501 CDD:290606 24/116 (21%)
IG_like 418..501 CDD:214653 23/114 (20%)
I-set 505..612 CDD:254352 20/116 (17%)
Ig 526..611 CDD:143165 18/94 (19%)
IG_like 633..715 CDD:214653 17/97 (18%)
Ig 635..713 CDD:143165 17/93 (18%)
FN3 720..838 CDD:238020 5/21 (24%)
FOL3NP_013831.1 FolC 3..427 CDD:223362 88/436 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.