DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and MET7

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_014884.1 Gene:MET7 / 854415 SGDID:S000005767 Length:548 Species:Saccharomyces cerevisiae


Alignment Length:542 Identity:96/542 - (17%)
Similarity:171/542 - (31%) Gaps:229/542 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EGSTVPLQSYALKGGSKNH------YTNATLQIV---------PRRADDGAKYKCVVWNRAMPEG 217
            :|||....| ::.|..|..      ||:..|:.|         |...:..|||...||:|.    
Yeast   131 KGSTAAFTS-SILGQYKEQLPRIGLYTSPHLKSVRERIRINGEPISEEKFAKYFFEVWDRL---- 190

  Fly   218 HMLETSVTLNVNYYPRVEVGPQNPLKVERDHVAKLDCRVDAKPMVSNVRWSRNG--QYVSATPTH 280
                .|.|.:::.:|.:..|                              |:.|  ::::....|
Yeast   191 ----DSTTSSLDKFPHMIPG------------------------------SKPGYFKFLTLLSFH 221

  Fly   281 TIYRVNRHHAGKYTCSADNGLGKTGEKDIVLDVLYPPI---VFIESKTHEAEEGETVLIRCNVTA 342
            |..:.:..     :|..:.|:|  ||.|.. :::..||   |.:....|....|:|:        
Yeast   222 TFIQEDCK-----SCVYEVGVG--GELDST-NIIEKPIVCGVTLLGIDHTFMLGDTI-------- 270

  Fly   343 NPSPINVEW-----LKEGAPDF---RYTGELLTLGSVRAEHAGNYICRSVNIMQ--PFSSKRVEG 397
                ..:.|     .|.|||.|   :...:.||:...|||.      |...:.:  ||  |::|.
Yeast   271 ----EEIAWNKGGIFKSGAPAFTVEKQPPQGLTILKERAEE------RKTTLTEVPPF--KQLEN 323

  Fly   398 V----------GNSTVALLVRHRPGQAYITPNKPVVHVGNGV--TLTCSANPPGWPVPQYRWFRD 450
            |          .|:::|:::.           ..::|..|.:  .:.||:|.   .:|:      
Yeast   324 VKLGIAGEFQKSNASLAVMLA-----------SEILHTSNILEEKIKCSSNA---SIPE------ 368

  Fly   451 MDGDIGNTQKILAQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHM 515
                            ::.|...:...||:  |..:.:   ||....|...|..           
Yeast   369 ----------------KFIIGLQNTKWEGR--CQVLEK---GKNVWYIDGAHTK----------- 401

  Fly   516 TRRVGDVDYAVTCSAKGKPTPQIRWIKDGTEILPTRKMFDIRTTPTDAGGGVVAVQSILRFRGKA 580
                   |..|..|.         |.:|...:...:|                    ||.|..::
Yeast   402 -------DSMVAAST---------WFRDMVRLSKRKK--------------------ILLFNQQS 430

  Fly   581 RPNGNQLLPNDRGLYTCL---------------------YENDVNSANSSMH----LRIEHEPIV 620
            | :.|.|:.|   ||:.:                     |..|:.|.|:|..    |:::..  :
Yeast   431 R-DANALVNN---LYSSVSPEITFDDVIFTTNVTWKSGSYSADLVSMNTSQEDVEKLKVQES--L 489

  Fly   621 IHQYNKVAYDLRESAEVVCRVQ 642
            :..:||:. |.|....|...::
Yeast   490 VKNWNKID-DNRAKTHVTASIE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653 19/74 (26%)
Ig 147..228 CDD:299845 19/74 (26%)
I-set 232..313 CDD:254352 12/82 (15%)
IGc2 250..302 CDD:197706 6/53 (11%)
IG_like 323..385 CDD:214653 15/69 (22%)
IGc2 330..385 CDD:197706 14/62 (23%)
Ig_2 416..501 CDD:290606 13/86 (15%)
IG_like 418..501 CDD:214653 13/84 (15%)
I-set 505..612 CDD:254352 20/131 (15%)
Ig 526..611 CDD:143165 19/105 (18%)
IG_like 633..715 CDD:214653 1/10 (10%)
Ig 635..713 CDD:143165 1/8 (13%)
FN3 720..838 CDD:238020
MET7NP_014884.1 folC 100..542 CDD:273659 96/542 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.