DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and RMA1

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_012790.1 Gene:RMA1 / 853727 SGDID:S000001615 Length:430 Species:Saccharomyces cerevisiae


Alignment Length:414 Identity:80/414 - (19%)
Similarity:146/414 - (35%) Gaps:111/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 SILRFRGKARPNGNQLLPNDRGLYTC-----LYENDVNSANSSMHLRIEHEPIVIHQYNKVAYDL 631
            |||:..|:.|   .::|   .|.||.     ..|.|::         |.:|.|.:.:|:::..:|
Yeast    47 SILQHPGQQR---QRVL---IGRYTTSSLLNAKEEDIS---------INNEAISLIEYSRIEKEL 96

  Fly   632 RE---SAEVVCR---------VQAYPKPEFQWQYGNNPSPLTMSSDGHYEISTRMENNDVYTSIL 684
            .|   |.::.|.         :..:.|...||..                |.|.:.......||:
Yeast    97 IEADSSLKLQCNNLELLTSVALVYFAKKNCQWCI----------------IETGLAGKQDPGSII 145

  Fly   685 --------RIAHLQHSDYGEYIC------------RAVNPLDS-----IRAPI--RLQPKGSPEK 722
                    .|.::..||.. ::|            :|:..||.     :|..|  |....|.|.:
Yeast   146 AGQSRVCCAITNVGISDEA-FLCKFLSQITESSTNKAIFLLDGSNDEFVRNTITKRCHDVGCPLE 209

  Fly   723 PTNLKILEVGHNYAVLNW-TPGFNGGFMSTKYLVSYRRVATPREQTLSD----CSGNGYIPSYQI 782
            .|:..:.:  :|.....| |......:...:|.:...|||......||.    |.....:....|
Yeast   210 ITDPSLRD--YNVHTDTWGTLEVRLPYSEEEYQIFNLRVAIAVLDFLSKEKKVCISKDQLSQGLI 272

  Fly   783 SSSSSNSNHEWIEFNCFKENPCKLAPL---DQHQSYMFKVYALNSKGTSGYS--NEILATTKVSK 842
            |.....|.|. ::: |::....|...|   :.:.:...:..|.:.:.|.|.:  ..::|.|...|
Yeast   273 SVDWPRSLHR-LDY-CYESTSGKKIALLLDNANNAKAARNLACHLRTTYGDTPLTFVIAITTGKK 335

  Fly   843 IPPPLHVSYDPNSHVLGINVAATC----------LSLIAVVESLVTRDATV-----PMWEIVET- 891
            :.|.|.....|..:|:.....:..          ::|:|.:::..||:..:     .:|..:|| 
Yeast   336 VSPLLDPLIRPQDYVIVTRFGSVVGMPWIQSLEPVNLLAFIKNRYTRNVNMQPDLQSVWTFLETS 400

  Fly   892 --LTLLP---SGSETTFKEAIINH 910
              .|::|   .||....||.:..|
Yeast   401 GLKTIVPVIVCGSLYICKELLRLH 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653
Ig 147..228 CDD:299845
I-set 232..313 CDD:254352
IGc2 250..302 CDD:197706
IG_like 323..385 CDD:214653
IGc2 330..385 CDD:197706
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352 11/44 (25%)
Ig 526..611 CDD:143165 11/43 (26%)
IG_like 633..715 CDD:214653 20/120 (17%)
Ig 635..713 CDD:143165 17/113 (15%)
FN3 720..838 CDD:238020 23/127 (18%)
RMA1NP_012790.1 FolC 10..430 CDD:223362 80/414 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.