DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and Bcam

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_065232.1 Gene:Bcam / 57278 MGIID:1929940 Length:622 Species:Mus musculus


Alignment Length:510 Identity:123/510 - (24%)
Similarity:191/510 - (37%) Gaps:111/510 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GQLWLSIGLISG------------DDSLDTREGVDLVLKCRFTEHYDSTDFTFYWARWTCCPTLF 62
            |.|||:. |:||            ...::...|..:.|.|...||.:     .|...|.......
Mouse     9 GLLWLTF-LLSGYSGAQAELHVSVPPRVEVMRGEQVALDCTPREHPE-----HYVLEWFLVDGTG 67

  Fly    63 ENVAIGDVQLNSN--------------YRLDFRPSRGIYDLQIKNTSYNRDNGRFECRIKAKGTG 113
            ....:..|:...:              |.:|.|....|..:|:.:   .||   :.|.:||...|
Mouse    68 ARHRLASVEPQGSEFLGTVHSLGRVPPYEVDSRGRLVIAKVQVGD---GRD---YVCVVKAGAAG 126

  Fly   114 ADVHQEFYNLTVLTAPHPPMVTP--GNLAVATEEKPLELTCSSIGGSPDPMITWYREGS--TVPL 174
            ..  :...::.|...|....|:|  |.|:|..:......||||..|:|.|.|||||.|.  .||:
Mouse   127 TS--EATSSVRVFATPEDTEVSPNKGTLSVMDQFAQEIATCSSNNGNPVPRITWYRNGQRLEVPM 189

  Fly   175 Q----SY----ALKGGSKNHYTNATLQIVPRRADDGAKYKCVVWNRAMPEG-HMLETSVTLNVN- 229
            :    .|    .::..|..:...:||.:...:.|..|.:.|.. :..:|.| |....|.|..:. 
Mouse   190 EVNQKGYITIRTVREASGLYSLTSTLYLRLHKDDRDANFHCAA-HYDLPSGQHGRLDSHTFRLTL 253

  Fly   230 YYP--RVEVGPQNPLKVE----RDHVAKLDCRVDAKPMVSNVRWSRNGQY-----VSATPTHTIY 283
            :||  .||....:|...|    .....:|.|:.|..|......:.:.|..     |:.....|:.
Mouse   254 HYPTEHVEFWVGSPSTTEGWVREGDAVQLLCQGDGSPSPEYSFFRQQGTQEEQLNVNLKGNLTLE 318

  Fly   284 RVNRHHAGKYTC-----SADNGLGKTGEKDIVLDVLY-PPI---------VFIESKTHEAEEGET 333
            ||:|:.:|.|.|     .||..:...  |.:.|.|.| .|:         ||:.|        .:
Mouse   319 RVHRNQSGIYGCRVEDYDADEEVQLV--KKLKLHVAYLDPLELSVPEELFVFLNS--------SS 373

  Fly   334 VLIRCNVTANPSPINVEWLKEGAPDFRYTGELLTLGSVRAEHAGNYICRSVNIMQPFSSKRVEGV 398
            .::.|:....|:| .|.|.|:...  ...|.:|:|.||..:.||.|.|.:.....|..|:     
Mouse   374 TVVNCSARGLPTP-TVRWTKDSVT--LADGPMLSLQSVTFDSAGTYTCEASTPTVPLLSR----- 430

  Fly   399 GNSTVALLVRHRPGQAYITPNKPVVHVGNG------VTLTCSANPPGWPVPQYRW 447
             ..:..|:|:   |...:.||:.:...||.      |.|||||.  |:|.|:..|
Mouse   431 -TQSFQLIVQ---GAPELKPNEIMPKSGNSWTEGDEVMLTCSAR--GFPEPKLTW 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250 32/108 (30%)
Ig strand B 148..152 CDD:409353 0/3 (0%)
Ig strand C 162..166 CDD:409353 2/3 (67%)
Ig strand E 190..194 CDD:409353 2/3 (67%)
Ig strand F 204..209 CDD:409353 1/4 (25%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 238..313 CDD:472250 19/88 (22%)
Ig strand B 250..254 CDD:409353 1/3 (33%)
Ig strand C 264..268 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 0/3 (0%)
Ig strand F 292..297 CDD:409353 2/9 (22%)
Ig strand G 306..309 CDD:409353 1/2 (50%)
Ig_3 316..385 CDD:464046 19/77 (25%)
Ig_2 416..501 CDD:464026 14/38 (37%)
Ig 523..614 CDD:472250
Ig strand B 524..528 CDD:409568
Ig strand C 537..541 CDD:409568
Ig strand E 566..570 CDD:409568
Ig strand F 594..599 CDD:409568
Ig strand G 607..610 CDD:409568
Ig_3 618..703 CDD:464046
FN3 720..838 CDD:238020
BcamNP_065232.1 IG_like 32..136 CDD:214653 19/116 (16%)
Ig strand B 43..47 CDD:409353 1/3 (33%)
Ig strand C 57..61 CDD:409353 0/3 (0%)
Ig strand E 101..105 CDD:409353 0/3 (0%)
Ig strand F 115..119 CDD:409353 1/6 (17%)
C2-set_2 144..241 CDD:400489 29/97 (30%)
Ig strand C 175..179 CDD:409353 2/3 (67%)
Ig strand E 213..217 CDD:409353 2/3 (67%)
Ig strand F 227..232 CDD:409353 1/4 (25%)
Ig_3 264..333 CDD:464046 15/68 (22%)
Ig_3 356..421 CDD:464046 19/75 (25%)
Ig_3 458..520 CDD:464046 10/24 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..622
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.