DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and KIRREL1

DIOPT Version :10

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:897 Identity:191/897 - (21%)
Similarity:321/897 - (35%) Gaps:251/897 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIIGQLWLSIGLISGDDSLDTREGVD--------LVLKCRFTEHYDSTDFTFYWARWTCCPTLFE 63
            |::..|.||.....|..:..::|..|        .||.|... :|...      .:||     .:
Human     4 LLVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPCVLL-NYSGI------VQWT-----KD 56

  Fly    64 NVAIG---DVQLNSNYRLDFRPSRGIYDLQIKNTSYNRDNGRFECRIKAKGTGADVHQEFYNLTV 125
            .:|:|   .::....||:......|.|:|:|.:...: |:..:||    :.|.|.:......|||
Human    57 GLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELS-DDASYEC----QATEAALRSRRAKLTV 116

  Fly   126 LTAPHPPMVTPGNLAVATEEKPLELTCSSIGGSPDPMITWYREGST---VPLQSYALKGGSKNHY 187
            |..|....:..|.:.:.....|..|||.:....|...|.|:|:|:.   ....:..||.| |...
Human   117 LIPPEDTRIDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDG-KRET 180

  Fly   188 TNATLQIVPRRADDGAKYKCVVWNRAMPEGHMLETSVTLNVNYYPRV--EVGPQNPLKVERDHVA 250
            |.:.|.|.|...|.|..:.|...|.|:|.|.  |||:.|:|::.|.|  .:.||...:.||   .
Human   181 TVSQLLINPTDLDIGRVFTCRSMNEAIPSGK--ETSIELDVHHPPTVTLSIEPQTVQEGER---V 240

  Fly   251 KLDCRVDAKPMVSNVRWSRNGQYVSATPTHTIYRVNRHHAGKY-------------TCSADNGLG 302
            ...|:..|.|.:...||::.|           :.:...|..:|             :|...|.:|
Human   241 VFTCQATANPEILGYRWAKGG-----------FLIEDAHESRYETNVDYSFFTEPVSCEVHNKVG 294

  Fly   303 KTGEKDIVLDVLYPPIVFIESKTHEAEEGETVLIRCNVTANPSPINVEWLKEGA----------P 357
            .|....:| :|.:.|.:.::.|....:.|..|.:.|....|| |:.:.|.|:.:          |
Human   295 STNVSTLV-NVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNP-PLTLTWTKKDSNMGPRPPGSPP 357

  Fly   358 DFRYTGELLT------LGSVRAEHAGNYICRSVNIMQPFSSKRVEGVGNSTVALLVRHRPGQAYI 416
            :...:.::|:      |.||....||.|.||::       ..|: ||....|.|.|...|    |
Human   358 EAALSAQVLSNSNQLLLKSVTQADAGTYTCRAI-------VPRI-GVAEREVPLYVNGPP----I 410

  Fly   417 TPNKPVVHV--GNGVTLTC---SANPPGWPVPQYRW-FRDMDGDIGNTQKILAQGPQYSIPKAHL 475
            ..::.|.:.  |:|..:.|   |..||    .:..| :::...::|..::       |::.:.:.
Human   411 ISSEAVQYAVRGDGGKVECFIGSTPPP----DRIAWAWKENFLEVGTLER-------YTVERTNS 464

  Fly   476 GS----------------EGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDY 524
            ||                :..|:|.|.|..|.|   |.|::          |::.....||.:..
Human   465 GSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG---TAIIQ----------LEEREVLPVGIIAG 516

  Fly   525 AVTCSA------------------KGKPTPQIRWIKDGTEILPTRKMFDIR---------TTPTD 562
            |...::                  ||..       ||.|    .||: ||:         |..:|
Human   517 ATIGASILLIFFFIALVFFLYRRRKGSR-------KDVT----LRKL-DIKVETVNREPLTMHSD 569

  Fly   563 AGGGVVAVQSILRFRGKARPNGNQLLPNDRGLYTCLYENDVNSAN----SSMHLRIEHE---PIV 620
            ......:|.:..|..              :.:|:. :::||:...    .::..|.|:|   | .
Human   570 REDDTASVSTATRVM--------------KAIYSS-FKDDVDLKQDLRCDTIDTREEYEMKDP-T 618

  Fly   621 IHQYNKVAYDLRESAEVVCRVQAYPKPEFQWQYGNNPSPLTMSSDGHYEISTRMENNDVYTSILR 685
            ...||..|::.|.|:..|.             |.:..:|.....||  ..|:|:.::..|..:..
Human   619 NGYYNVRAHEDRPSSRAVL-------------YADYRAPGPARFDG--RPSSRLSHSSGYAQLNT 668

  Fly   686 IAHLQHSDYGEYICRAVNPLDSIRAPIRLQPKGSPEKP-----TNLKILEVGHNYAVLNWTPGFN 745
            .:....||||                    |:.:|..|     |:........||...|..| |.
Human   669 YSRGPASDYG--------------------PEPTPPGPAAPAGTDTTSQLSYENYEKFNSHP-FP 712

  Fly   746 GGFMSTKYLVSYRRV------ATPREQTLSDCSGNGYIPSYQISSSSSNSNH 791
            |......|.:.|.:.      .||.|  ..|..|. |..:.:.|.:|.:|::
Human   713 GAAGYPTYRLGYPQAPPSGLERTPYE--AYDPIGK-YATATRFSYTSQHSDY 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 132..228 CDD:472250 29/98 (30%)
Ig strand B 148..152 CDD:409353 1/3 (33%)
Ig strand C 162..166 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 1/4 (25%)
Ig strand G 221..224 CDD:409353 2/2 (100%)
Ig 238..313 CDD:472250 17/87 (20%)
Ig strand B 250..254 CDD:409353 0/3 (0%)
Ig strand C 264..268 CDD:409353 1/3 (33%)
Ig strand E 278..282 CDD:409353 0/3 (0%)
Ig strand F 292..297 CDD:409353 2/17 (12%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Ig_3 316..385 CDD:464046 20/84 (24%)
Ig_2 416..501 CDD:464026 21/106 (20%)
Ig 523..614 CDD:472250 17/121 (14%)
Ig strand B 524..528 CDD:409568 1/3 (33%)
Ig strand C 537..541 CDD:409568 0/3 (0%)
Ig strand E 566..570 CDD:409568 0/3 (0%)
Ig strand F 594..599 CDD:409568 1/4 (25%)
Ig strand G 607..610 CDD:409568 0/6 (0%)
Ig_3 618..703 CDD:464046 18/84 (21%)
FN3 720..838 CDD:238020 20/83 (24%)
KIRREL1XP_005245362.1 Ig 22..116 CDD:472250 22/110 (20%)
Ig strand B 38..42 CDD:409353 2/3 (67%)
Ig strand C 51..54 CDD:409353 0/2 (0%)
Ig strand E 78..87 CDD:409353 3/8 (38%)
Ig strand F 97..102 CDD:409353 2/8 (25%)
Ig strand G 109..112 CDD:409353 0/2 (0%)
IgI_2_KIRREL3-like 122..219 CDD:409416 29/99 (29%)
Ig strand A 123..126 CDD:409416 0/2 (0%)
Ig strand A' 129..133 CDD:409416 0/3 (0%)
Ig strand B 140..147 CDD:409416 3/6 (50%)
Ig strand C 152..157 CDD:409416 1/4 (25%)
Ig strand C' 160..162 CDD:409416 1/1 (100%)
Ig strand D 165..172 CDD:409416 0/6 (0%)
Ig strand E 179..187 CDD:409416 2/7 (29%)
Ig strand F 196..204 CDD:409416 1/7 (14%)
Ig strand G 210..216 CDD:409416 4/7 (57%)
Ig_3 222..291 CDD:464046 15/82 (18%)
Ig_3 308..389 CDD:464046 19/81 (23%)
IgI_5_KIRREL3 407..504 CDD:409479 22/124 (18%)
Ig strand A 408..412 CDD:409479 2/7 (29%)
Ig strand A' 414..417 CDD:409479 0/2 (0%)
Ig strand B 425..432 CDD:409479 1/6 (17%)
Ig strand C 439..444 CDD:409479 1/4 (25%)
Ig strand C' 446..449 CDD:409479 0/2 (0%)
Ig strand D 457..464 CDD:409479 1/6 (17%)
Ig strand E 467..474 CDD:409479 0/6 (0%)
Ig strand F 485..492 CDD:409479 3/6 (50%)
Ig strand G 495..502 CDD:409479 4/9 (44%)

Return to query results.
Submit another query.