DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fred and fpgs

DIOPT Version :9

Sequence 1:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster
Sequence 2:NP_998602.2 Gene:fpgs / 406746 ZFINID:ZDB-GENE-040426-2781 Length:572 Species:Danio rerio


Alignment Length:295 Identity:63/295 - (21%)
Similarity:99/295 - (33%) Gaps:90/295 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   606 ANSSMHLRIEHEPIVIHQYNKVAYDLRESAEVVCRVQAY-PKP-------EFQWQYGNNPS---- 658
            :|:|:.|::.|..:..|.....|..:..|.  |....|: |.|       |.:|. |.|.:    
Zfish   305 SNASLALQLSHTWLQRHILTDPASPVEFSG--VSSAPAFQPSPAMIKGLAETEWP-GRNQTLKHG 366

  Fly   659 PLTMSSDGHY-------------EISTRMENNDVYTSILRIAHLQHSDYGEYICRAVNPLDSIRA 710
            |:|...||.:             |::|:.|.| ...|:||:  |..:..||..|.|:        
Zfish   367 PVTYYMDGAHTTRSMQACVRWFNEVATQHERN-AGGSVLRV--LLFNATGERDCAAM-------- 420

  Fly   711 PIRLQPKGSPEKPTNLKILEVGH-NYAVLNWTPGFNGGFMSTKYLVSYRRVATPREQTLSDCSGN 774
                           ||:|...| ::||  :.|.......|..  ...:......|..|:.|..|
Zfish   421 ---------------LKLLAPCHFDFAV--FCPNITEAIASCN--ADQQNFNVSVENMLTRCLDN 466

  Fly   775 GYIPSYQISSSSSNSNHEWIEFNCFKENP-CKL-----APL--DQH-QSYMFKVYALNSKGTSGY 830
                           ...|...|..:|.| .:|     .||  ::| .:.:|.......:..|..
Zfish   467 ---------------QQSWRVLNGHEEKPEAELLIGGGLPLVAERHGDTLVFPCILSALQWISQG 516

  Fly   831 SNEILATTKVSKIP--PPLHVSYDP-----NSHVL 858
            .:.:||......||  |.::....|     |.|||
Zfish   517 RDSVLADANKHTIPVKPSINAKAAPLREAQNIHVL 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653
Ig 147..228 CDD:299845
I-set 232..313 CDD:254352
IGc2 250..302 CDD:197706
IG_like 323..385 CDD:214653
IGc2 330..385 CDD:197706
Ig_2 416..501 CDD:290606
IG_like 418..501 CDD:214653
I-set 505..612 CDD:254352 2/5 (40%)
Ig 526..611 CDD:143165 2/4 (50%)
IG_like 633..715 CDD:214653 25/106 (24%)
Ig 635..713 CDD:143165 24/102 (24%)
FN3 720..838 CDD:238020 24/127 (19%)
fpgsNP_998602.2 PLN02881 47..566 CDD:215476 63/295 (21%)
Mur_ligase_C 356..437 CDD:280948 25/109 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0285
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.